prot_F-distichus_contig10025.29.1 (polypeptide) Fucus distichus monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_F-distichus_contig10025.29.1
Unique Name	prot_F-distichus_contig10025.29.1
Type	polypeptide
Organism	Fucus distichus monoicous (Fucus distichus monoicous)
Sequence length	259

Homology

[Close]

BLAST of mRNA_F-distichus_contig10025.29.1 vs. uniprot
Match: D7FI22_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI22_ECTSI)

HSP 1 Score: 162 bits (409), Expect = 5.460e-42
Identity = 103/242 (42.56%), Postives = 157/242 (64.88%), Query Frame = 0

Query:    2 FSLPRHSPSRGRIAAARIDSIILALVADDSIDGSKGGSGNGSLK------GDRGGDKAPL-----LSSA----------DVRKVVAHMDTDQSGEVDAKELEMAISAAKQGKLKDAQLMHCMLKIDNELHLWHLRICDLFDRLDADGSGTLSYEELTKGLSMLCGHDRNEIIQRRQELRRRNEEKKAQEIERRACVMGFVSNMESLPEEIMQDREFFATDVTDNETFHELLKKISRKVNEEV 222
             S+PR + SRGR+A  RID+I+ AL +    + +    G GS++      GD  G  + L     LSS+          +V  V+ ++D DQSGEVDA++ + AISAAKQGK+ D  L   + +I++ L L +LRI D+F  +D+DGSG LS+ EL +GLS+L  HDR+++I+RRQ LRRR E++K++E  +RA V  F+++M SL EE +++REFFAT+VTD + F +++++IS +   E 
Sbjct:  137 LSIPRSTISRGRVAKVRIDAILHALESGWWSEEA----GRGSMRIFRGSFGDCAGASSTLSASMTLSSSSSSLSSLTLEEVEAVIVYVDKDQSGEVDARDFQAAISAAKQGKIPDQGLAGSIRRINDMLRLHNLRIRDVFHVMDSDGSGKLSHRELAQGLSLLYEHDRDKVIERRQALRRRKEQQKSKEDGKRAKVAAFLTSMGSLQEESLREREFFATEVTDEDLFQDIVQRISNETGYET 374

The following BLAST results are available for this feature:

BLAST of mRNA_F-distichus_contig10025.29.1 vs. uniprot

BLAST of mRNA_F-distichus_contig10025.29.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 1


Match Name	E-value	Identity	Description
D7FI22_ECTSI	5.460e-42	42.56	Uncharacterized protein n=1 Tax=Ectocarpus silicul...	[more]

InterPro

Analysis Name: OGS1.0 of Fucus distichus monoicous
Date Performed: 2021-02-24


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	COILS	Coil	Coil	coord: 148..173
None	No IPR available	GENE3D	1.10.238.10		coord: 49..171 e-value: 3.3E-11 score: 45.0
IPR002048	EF-hand domain	SMART	SM00054	efh_1	coord: 60..88 e-value: 0.94 score: 18.0 coord: 115..143 e-value: 0.062 score: 22.4
IPR002048	EF-hand domain	PFAM	PF13202	EF-hand_5	coord: 118..138 e-value: 1.4E-4 score: 21.2
IPR002048	EF-hand domain	PROSITE	PS50222	EF_HAND_2	coord: 56..91 score: 11.166
IPR002048	EF-hand domain	PROSITE	PS50222	EF_HAND_2	coord: 118..146 score: 11.333
IPR018247	EF-Hand 1, calcium-binding site	PROSITE	PS00018	EF_HAND_1	coord: 124..136
IPR018247	EF-Hand 1, calcium-binding site	PROSITE	PS00018	EF_HAND_1	coord: 69..81
IPR011992	EF-hand domain pair	SUPERFAMILY	47473	EF-hand	coord: 115..227
IPR011992	EF-hand domain pair	SUPERFAMILY	47473	EF-hand	coord: 60..151

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	COILS	Coil	Coil	coord: 148..173
None	No IPR available	GENE3D	1.10.238.10		coord: 49..171 e-value: 3.3E-11 score: 45.0
IPR002048	EF-hand domain	SMART	SM00054	efh_1	coord: 60..88 e-value: 0.94 score: 18.0 coord: 115..143 e-value: 0.062 score: 22.4
IPR002048	EF-hand domain	PFAM	PF13202	EF-hand_5	coord: 118..138 e-value: 1.4E-4 score: 21.2
IPR002048	EF-hand domain	PROSITE	PS50222	EF_HAND_2	coord: 56..91 score: 11.166
IPR002048	EF-hand domain	PROSITE	PS50222	EF_HAND_2	coord: 118..146 score: 11.333
IPR018247	EF-Hand 1, calcium-binding site	PROSITE	PS00018	EF_HAND_1	coord: 124..136
IPR018247	EF-Hand 1, calcium-binding site	PROSITE	PS00018	EF_HAND_1	coord: 69..81
IPR011992	EF-hand domain pair	SUPERFAMILY	47473	EF-hand	coord: 115..227
IPR011992	EF-hand domain pair	SUPERFAMILY	47473	EF-hand	coord: 60..151

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
F-distichus_contig10025	contig	F-distichus_contig10025:8947..11118 -

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-09-29
Diamond blastp: OGS1.0 vs UniRef90	2022-09-16
OGS1.0 of Fucus distichus monoicous	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_F-distichus_contig10025.29.1	mRNA_F-distichus_contig10025.29.1	Fucus distichus monoicous	mRNA	F-distichus_contig10025 8947..11139 -

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_F-distichus_contig10025.29.1 ID=prot_F-distichus_contig10025.29.1|Name=mRNA_F-distichus_contig10025.29.1|organism=Fucus distichus monoicous|type=polypeptide|length=259bp
MFSLPRHSPSRGRIAAARIDSIILALVADDSIDGSKGGSGNGSLKGDRGG
DKAPLLSSADVRKVVAHMDTDQSGEVDAKELEMAISAAKQGKLKDAQLMH
CMLKIDNELHLWHLRICDLFDRLDADGSGTLSYEELTKGLSMLCGHDRNE
IIQRRQELRRRNEEKKAQEIERRACVMGFVSNMESLPEEIMQDREFFATD
VTDNETFHELLKKISRKVNEEVMYDDITCQMNDRSNDGDGQDDCGSLVEG
ADGNVVRRR

Annotated Terms

The following terms have been associated with this polypeptide:

Vocabulary: **INTERPRO**
Term	Definition
IPR002048	EF_hand_dom
IPR018247	EF_Hand_1_Ca_BS
IPR011992	EF-hand-dom_pair