EsuBft954_8 (polypeptide) Ectocarpus subulatus male Bft15b

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of EsuBft954_8a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 17
ZOOM
x 1
POSITION
0
MMGVPPCFYCGPDSTSTLWHLKRLGSKDFNETWESLHACVGHNPADLQPFHGMFPDWDDKHAEEELEDSAASPLAKRYYTNMELYGLLRPDQSDLPYVYDNFAWPHCSVLGEDMVA102030405060708090100110Expect = 1.20e-88 / Id = 100.00Expect = 1.03e-58 / Id = 88.35Expect = 1.69e-25 / Id = 45.45Expect = 3.92e-25 / Id = 54.00Expect = 9.54e-24 / Id = 52.53Expect = 1.37e-23 / Id = 47.47Expect = 3.67e-23 / Id = 46.85Expect = 1.86e-22 / Id = 46.39Expect = 6.56e-22 / Id = 52.53Expect = 1.10e-20 / Id = 51.52SequenceA0A6H5L8Z7_9PHAED7FNR4_ECTSIA0A7S2BER4_9STRAA0A6H5K6J0_9PHAEA0A6H5KFU1_9PHAEA0A7S2BC73_9STRAD7G1K2_ECTSIA0A7S2R7L9_9STRAD8LAY9_ECTSIA0A6H5JTC5_9PHAE
Match NameE-valueIdentityDescription
A0A6H5L8Z7_9PHAE1.200e-88100.00Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
D7FNR4_ECTSI1.030e-5888.35Tyrosinase-like protein 2 n=1 Tax=Ectocarpus silic... [more]
A0A7S2BER4_9STRA1.690e-2545.45Hypothetical protein n=1 Tax=Florenciella parvula ... [more]
A0A6H5K6J0_9PHAE3.920e-2554.00Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5KFU1_9PHAE9.540e-2452.53Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A7S2BC73_9STRA1.370e-2347.47Hypothetical protein n=1 Tax=Dictyocha speculum Ta... [more]
D7G1K2_ECTSI3.670e-2346.85Hypothetical tyrosinase-like protein F21C3.2 in ch... [more]
A0A7S2R7L9_9STRA1.860e-2246.39Hypothetical protein n=3 Tax=Rhizochromulina marin... [more]
D8LAY9_ECTSI6.560e-2252.53Putative scytonemin-related tyrosinase n=1 Tax=Ect... [more]
A0A6H5JTC5_9PHAE1.100e-2051.52TYR protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 Ta... [more]

Pages

back to top
BLAST of EsuBft954_8a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90)
Total hits: 17
ZOOM
x 1
POSITION
0
MMGVPPCFYCGPDSTSTLWHLKRLGSKDFNETWESLHACVGHNPADLQPFHGMFPDWDDKHAEEELEDSAASPLAKRYYTNMELYGLLRPDQSDLPYVYDNFAWPHCSVLGEDMVA102030405060708090100110Expect = 2.49e-88 / Id = 100.00Expect = 2.08e-58 / Id = 88.35Expect = 3.31e-25 / Id = 45.45Expect = 7.69e-25 / Id = 54.00Expect = 1.87e-23 / Id = 52.53Expect = 2.68e-23 / Id = 47.47Expect = 7.00e-23 / Id = 46.85Expect = 3.57e-22 / Id = 46.39Expect = 1.25e-21 / Id = 52.53Expect = 2.09e-20 / Id = 51.52SequenceA0A6H5L8Z7_9PHAED7FNR4_ECTSIA0A7S2BER4_9STRAA0A6H5K6J0_9PHAEA0A6H5KFU1_9PHAEA0A7S2BC73_9STRAD7G1K2_ECTSIA0A7S2R7L9_9STRAD8LAY9_ECTSIA0A6H5JTC5_9PHAE
Match NameE-valueIdentityDescription
A0A6H5L8Z7_9PHAE2.490e-88100.00Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
D7FNR4_ECTSI2.080e-5888.35Tyrosinase-like protein 2 n=1 Tax=Ectocarpus silic... [more]
A0A7S2BER4_9STRA3.310e-2545.45Hypothetical protein n=1 Tax=Florenciella parvula ... [more]
A0A6H5K6J0_9PHAE7.690e-2554.00Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5KFU1_9PHAE1.870e-2352.53Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A7S2BC73_9STRA2.680e-2347.47Hypothetical protein n=1 Tax=Dictyocha speculum Ta... [more]
D7G1K2_ECTSI7.000e-2346.85Hypothetical tyrosinase-like protein F21C3.2 in ch... [more]
A0A7S2R7L9_9STRA3.570e-2246.39Hypothetical protein n=3 Tax=Rhizochromulina marin... [more]
D8LAY9_ECTSI1.250e-2152.53Putative scytonemin-related tyrosinase n=1 Tax=Ect... [more]
A0A6H5JTC5_9PHAE2.090e-2051.52TYR protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 Ta... [more]

Pages

back to top