EsuBft986_12 (polypeptide) Ectocarpus subulatus male Bft15b

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of EsuBft986_12a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 4
ZOOM
x 1
POSITION
0
MAHPLRSISMDLAAVAPVVHLPRFDVGGGTGSSSYWEQRFGDGYFDPSSFIPSYTTTDKVLAIFRLAVGTILVVLGSYPLVRFYRSRWILDIRTR102030405060708090Expect = 2.61e-62 / Id = 100.00Expect = 4.53e-18 / Id = 62.16Expect = 4.53e-18 / Id = 63.64Expect = 7.13e-17 / Id = 59.46SequenceA0A6H5LR03_9PHAEA0A6H5JE98_9PHAED7G2T8_ECTSID7FTW0_ECTSI
Match NameE-valueIdentityDescription
A0A6H5LR03_9PHAE2.610e-62100.00Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5JE98_9PHAE4.530e-1862.16RGS domain-containing protein n=1 Tax=Ectocarpus s... [more]
D7G2T8_ECTSI4.530e-1863.64RGS domain-containing protein n=1 Tax=Ectocarpus s... [more]
D7FTW0_ECTSI7.130e-1759.46RGS domain-containing protein n=2 Tax=Ectocarpus s... [more]
back to top
BLAST of EsuBft986_12a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90)
Total hits: 4
ZOOM
x 1
POSITION
0
MAHPLRSISMDLAAVAPVVHLPRFDVGGGTGSSSYWEQRFGDGYFDPSSFIPSYTTTDKVLAIFRLAVGTILVVLGSYPLVRFYRSRWILDIRTR102030405060708090Expect = 2.01e-59 / Id = 100.00Expect = 8.84e-16 / Id = 62.16Expect = 8.91e-16 / Id = 63.64Expect = 1.13e-14 / Id = 59.46SequenceA0A6H5LR03_9PHAEA0A6H5JE98_9PHAED7G2T8_ECTSID7FTW0_ECTSI
Match NameE-valueIdentityDescription
A0A6H5LR03_9PHAE2.010e-59100.00Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5JE98_9PHAE8.840e-1662.16RGS domain-containing protein n=1 Tax=Ectocarpus s... [more]
D7G2T8_ECTSI8.910e-1663.64RGS domain-containing protein n=1 Tax=Ectocarpus s... [more]
D7FTW0_ECTSI1.130e-1459.46RGS domain-containing protein n=2 Tax=Ectocarpus s... [more]
back to top