EsuBft2191_4 (polypeptide) Ectocarpus subulatus male Bft15b

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of EsuBft2191_4a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MRSAVVSCLSGLLPRPSLVYGVNKDALSRRLSGAVAMDARVGPETAVLSKAEEDAVEDALIYACRHFLSFGRQQLIDAVRVLCLDGRPVP102030405060708090Expect = 1.62e-56 / Id = 100.00Expect = 2.57e-37 / Id = 95.77Expect = 1.67e-36 / Id = 94.37Expect = 2.43e-33 / Id = 88.73Expect = 3.34e-31 / Id = 90.14Expect = 3.92e-24 / Id = 91.07Expect = 8.30e-23 / Id = 90.74Expect = 1.02e-17 / Id = 61.97Expect = 3.82e-17 / Id = 61.97Expect = 5.54e-17 / Id = 61.97SequenceA0A6H5K643_9PHAEA0A6H5K1B1_9PHAEA0A6H5JJX4_9PHAEA0A6H5JDA5_9PHAEA0A6H5JY96_9PHAEA0A6H5JU53_9PHAEA0A6H5KW68_9PHAEA0A6H5L2N3_9PHAEA0A6H5JMR3_9PHAEA0A6H5LAK0_9PHAE
Match NameE-valueIdentityDescription
A0A6H5K643_9PHAE1.620e-56100.00Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5K1B1_9PHAE2.570e-3795.77HTH psq-type domain-containing protein n=1 Tax=Ect... [more]
A0A6H5JJX4_9PHAE1.670e-3694.37HTH psq-type domain-containing protein n=1 Tax=Ect... [more]
A0A6H5JDA5_9PHAE2.430e-3388.73HTH psq-type domain-containing protein n=1 Tax=Ect... [more]
A0A6H5JY96_9PHAE3.340e-3190.14DDE-1 domain-containing protein n=1 Tax=Ectocarpus... [more]
A0A6H5JU53_9PHAE3.920e-2491.07Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5KW68_9PHAE8.300e-2390.74HTH psq-type domain-containing protein n=2 Tax=Ect... [more]
A0A6H5L2N3_9PHAE1.020e-1761.97HTH psq-type domain-containing protein (Fragment) ... [more]
A0A6H5JMR3_9PHAE3.820e-1761.97HTH psq-type domain-containing protein (Fragment) ... [more]
A0A6H5LAK0_9PHAE5.540e-1761.97HTH psq-type domain-containing protein (Fragment) ... [more]

Pages

back to top
BLAST of EsuBft2191_4a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MRSAVVSCLSGLLPRPSLVYGVNKDALSRRLSGAVAMDARVGPETAVLSKAEEDAVEDALIYACRHFLSFGRQQLIDAVRVLCLDGRPVP102030405060708090Expect = 3.07e-62 / Id = 93.40Expect = 6.45e-62 / Id = 91.59Expect = 2.47e-60 / Id = 96.00Expect = 8.00e-59 / Id = 92.52Expect = 2.47e-55 / Id = 100.00Expect = 9.93e-52 / Id = 92.39Expect = 1.63e-42 / Id = 70.09Expect = 2.82e-42 / Id = 70.09Expect = 2.22e-39 / Id = 70.09Expect = 5.88e-39 / Id = 68.22SequenceA0A6H5JJX4_9PHAEA0A6H5JDA5_9PHAEA0A6H5K1B1_9PHAEA0A6H5JY96_9PHAEA0A6H5K643_9PHAEA0A6H5JU53_9PHAEA0A6H5JMR3_9PHAEA0A6H5LAK0_9PHAEA0A6H5JH77_9PHAEA0A6H5KK08_9PHAE
Match NameE-valueIdentityDescription
A0A6H5JJX4_9PHAE3.070e-6293.40HTH psq-type domain-containing protein n=1 Tax=Ect... [more]
A0A6H5JDA5_9PHAE6.450e-6291.59HTH psq-type domain-containing protein n=1 Tax=Ect... [more]
A0A6H5K1B1_9PHAE2.470e-6096.00HTH psq-type domain-containing protein n=1 Tax=Ect... [more]
A0A6H5JY96_9PHAE8.000e-5992.52DDE-1 domain-containing protein n=1 Tax=Ectocarpus... [more]
A0A6H5K643_9PHAE2.470e-55100.00Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5JU53_9PHAE9.930e-5292.39Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5JMR3_9PHAE1.630e-4270.09HTH psq-type domain-containing protein (Fragment) ... [more]
A0A6H5LAK0_9PHAE2.820e-4270.09HTH psq-type domain-containing protein (Fragment) ... [more]
A0A6H5JH77_9PHAE2.220e-3970.09S5A_REDUCTASE domain-containing protein n=1 Tax=Ec... [more]
A0A6H5KK08_9PHAE5.880e-3968.22Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]

Pages

back to top