EsuBft962_2 (polypeptide) Ectocarpus subulatus male Bft15b
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of EsuBft962_2a-0001 vs. uniprot
Match: A0A6H5KZV8_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KZV8_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 6.060e-17 Identity = 39/40 (97.50%), Postives = 39/40 (97.50%), Query Frame = 0 Query: 1 MVAFIAAFLLRAIDSVVSCPIIAAVLDKCTFPSIEQLGRR 40 MVAFIAAFLLRAIDSVVSC IIAAVLDKCTFPSIEQLGRR Sbjct: 1 MVAFIAAFLLRAIDSVVSCSIIAAVLDKCTFPSIEQLGRR 40
BLAST of EsuBft962_2a-0001 vs. uniprot
Match: A0A6H5KJK6_9PHAE (Valine--tRNA ligase n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJK6_9PHAE) HSP 1 Score: 85.5 bits (210), Expect = 5.590e-17 Identity = 39/45 (86.67%), Postives = 41/45 (91.11%), Query Frame = -3 Query: 600 KTHLPIDLPTPGVEEYRATTPWHATTPSFASDQSMIIQDACRPKR 734 K++LPIDLPTPGVE YR TTPWHATTPSFASDQSMI Q ACRPKR Sbjct: 73 KSYLPIDLPTPGVEGYRTTTPWHATTPSFASDQSMISQGACRPKR 117
BLAST of EsuBft962_2a-0001 vs. uniprot
Match: A0A6H5K3G4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3G4_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 1.960e-16 Identity = 40/51 (78.43%), Postives = 42/51 (82.35%), Query Frame = -3 Query: 594 MQIIKTHLPIDLPTPGVEEYRATTPWHATTPSFASDQSMIIQDACRPKRVK 746 M+ IKTHLPIDLPTPGVE YRA TPW ATTP+F DQSMI QDACRPK K Sbjct: 1 MRKIKTHLPIDLPTPGVEGYRAATPWQATTPAFTKDQSMICQDACRPKGFK 51
BLAST of EsuBft962_2a-0001 vs. uniprot
Match: A0A6H5K7K3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K7K3_9PHAE) HSP 1 Score: 89.0 bits (219), Expect = 2.160e-16 Identity = 47/67 (70.15%), Postives = 49/67 (73.13%), Query Frame = -3 Query: 546 MQIIKTHLPIDLPTPGVEEYRATTPWHATTPSFASDQSMIIQDACRPKRVKKTTPRGAVLLRAQVCV 746 M+IIKTHLPIDLP PGVE RATTPWHA TPSFASDQSMI QDACRP R A +L AQ V Sbjct: 1 MRIIKTHLPIDLPAPGVEGQRATTPWHAKTPSFASDQSMIGQDACRPTR----PAAAAAVLGAQPAV 63
BLAST of EsuBft962_2a-0001 vs. uniprot
Match: A0A6H5KZV8_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KZV8_9PHAE) HSP 1 Score: 75.9 bits (185), Expect = 1.020e-14 Identity = 39/40 (97.50%), Postives = 39/40 (97.50%), Query Frame = 1 Query: 1 MVAFIAAFLLRAIDSVVSCPIIAAVLDKCTFPSIEQLGRR 120 MVAFIAAFLLRAIDSVVSC IIAAVLDKCTFPSIEQLGRR Sbjct: 1 MVAFIAAFLLRAIDSVVSCSIIAAVLDKCTFPSIEQLGRR 40 The following BLAST results are available for this feature:
BLAST of EsuBft962_2a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
BLAST of EsuBft962_2a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft962_2 ID=EsuBft962_2|Name=EsuBft962_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=40bpback to top |