EsuBft947_7 (polypeptide) Ectocarpus subulatus male Bft15b
Overview
Homology
BLAST of EsuBft947_7a-0001 vs. uniprot
Match: A0A6H5L8S2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L8S2_9PHAE) HSP 1 Score: 79.7 bits (195), Expect = 2.550e-15 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 0 Query: 152 ASVFSHWWRFGFVDAVEVPIKCRLFMAGCPVKGR 185 ASVFSHWWRFGFVDAVEVPIKCRLFMAGCPVKGR Sbjct: 152 ASVFSHWWRFGFVDAVEVPIKCRLFMAGCPVKGR 185
BLAST of EsuBft947_7a-0001 vs. uniprot
Match: A0A6H5L8S2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L8S2_9PHAE) HSP 1 Score: 80.5 bits (197), Expect = 2.270e-15 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 3 Query: 519 ASVFSHWWRFGFVDAVEVPIKCRLFMAGCPVKGR 620 ASVFSHWWRFGFVDAVEVPIKCRLFMAGCPVKGR Sbjct: 152 ASVFSHWWRFGFVDAVEVPIKCRLFMAGCPVKGR 185 The following BLAST results are available for this feature:
BLAST of EsuBft947_7a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
BLAST of EsuBft947_7a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft947_7 ID=EsuBft947_7|Name=EsuBft947_7a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=185bpback to top |