EsuBft947_2 (polypeptide) Ectocarpus subulatus male Bft15b
Overview
Homology
BLAST of EsuBft947_2a-0001 vs. uniprot
Match: A0A6H5KDL9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDL9_9PHAE) HSP 1 Score: 58.5 bits (140), Expect = 3.790e-9 Identity = 30/34 (88.24%), Postives = 31/34 (91.18%), Query Frame = 2 Query: 56 CLLRKMDRGSSIYLCSLEVNSSVSSRS-NAPVYH 154 CLLRKMDRGSSIYLCSLEV +SVSS S NAPVYH Sbjct: 20 CLLRKMDRGSSIYLCSLEVINSVSSHSSNAPVYH 53 The following BLAST results are available for this feature:
BLAST of EsuBft947_2a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 0
BLAST of EsuBft947_2a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft947_2 ID=EsuBft947_2|Name=EsuBft947_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=50bpback to top |