EsuBft936_16 (polypeptide) Ectocarpus subulatus male Bft15b
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of EsuBft936_16a-0001 vs. uniprot
Match: A0A6H5L648_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L648_9PHAE) HSP 1 Score: 121 bits (303), Expect = 4.050e-35 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0 Query: 1 MKRELLLTPTAWRPAHLHLCTWRTSADPTPPLRTPRGGCAAARRYRSLEGESSPIR 56 MKRELLLTPTAWRPAHLHLCTWRTSADPTPPLRTPRGGCAAARRYRSLEGESSPIR Sbjct: 1 MKRELLLTPTAWRPAHLHLCTWRTSADPTPPLRTPRGGCAAARRYRSLEGESSPIR 56
BLAST of EsuBft936_16a-0001 vs. uniprot
Match: A0A6H5L648_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L648_9PHAE) HSP 1 Score: 122 bits (305), Expect = 3.050e-33 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 1 Query: 1 MKRELLLTPTAWRPAHLHLCTWRTSADPTPPLRTPRGGCAAARRYRSLEGESSPIR 168 MKRELLLTPTAWRPAHLHLCTWRTSADPTPPLRTPRGGCAAARRYRSLEGESSPIR Sbjct: 1 MKRELLLTPTAWRPAHLHLCTWRTSADPTPPLRTPRGGCAAARRYRSLEGESSPIR 56
BLAST of EsuBft936_16a-0001 vs. uniprot
Match: A0A6H5JY20_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JY20_9PHAE) HSP 1 Score: 100 bits (250), Expect = 6.720e-25 Identity = 49/58 (84.48%), Postives = 49/58 (84.48%), Query Frame = -1 Query: 23 TERGGGGLSSE*G*THPQGTDTFLLRRTRREACAVVELGRHWCARYKGADARASRRSV 196 T GGGLSSE G THPQGTDTFLLRRTRREAC VVELGRHWC RYKGADAR SR SV Sbjct: 2 THSEGGGLSSEQGWTHPQGTDTFLLRRTRREACVVVELGRHWCVRYKGADARVSRPSV 59
BLAST of EsuBft936_16a-0001 vs. uniprot
Match: A0A6H5LLA6_9PHAE (Uncharacterized protein n=13 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LLA6_9PHAE) HSP 1 Score: 84.3 bits (207), Expect = 1.760e-18 Identity = 42/47 (89.36%), Postives = 42/47 (89.36%), Query Frame = 3 Query: 3 EKGIAAYTDRLEARASAPLYLAHQCRPNSTTAHASRRVRRSKKVSVP 143 E GIAAYTD LEARASAPLYL HQCRPNSTT HASRRVRR KKVSVP Sbjct: 10 EMGIAAYTDGLEARASAPLYLTHQCRPNSTTTHASRRVRRFKKVSVP 56
BLAST of EsuBft936_16a-0001 vs. uniprot
Match: A0A6H5K147_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K147_9PHAE) HSP 1 Score: 90.5 bits (223), Expect = 1.040e-17 Identity = 46/71 (64.79%), Postives = 48/71 (67.61%), Query Frame = 2 Query: 11 NCCLHRPPGGPRICTFVPGAPVPTQLHHCARLAAGAPQQEGIGPLRVS-----------LALFARKTSPPP 190 CCLHR PGGPRICTF+P APVP QLHH ARLAAGAPQQE IGPLR S L+L TSP P Sbjct: 9 TCCLHRRPGGPRICTFLPDAPVPIQLHHYARLAAGAPQQEAIGPLRTSRIFPGTFFARSLSLRRYSTSPHP 79
BLAST of EsuBft936_16a-0001 vs. uniprot
Match: A0A6H5L0B9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0B9_9PHAE) HSP 1 Score: 81.6 bits (200), Expect = 2.810e-17 Identity = 39/45 (86.67%), Postives = 40/45 (88.89%), Query Frame = 2 Query: 35 GGPRICTFVPGAPVPTQLHHCARLAAGAPQQEGIGPLRVSLALFA 169 GGPR+CT V GAPVPTQLHH ARLAAGAPQQEG GPLRVSLAL A Sbjct: 21 GGPRMCTIVSGAPVPTQLHHYARLAAGAPQQEGAGPLRVSLALLA 65
BLAST of EsuBft936_16a-0001 vs. uniprot
Match: A0A6H5KDN3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDN3_9PHAE) HSP 1 Score: 80.5 bits (197), Expect = 5.530e-17 Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 3 Query: 3 EKGIAAYTDRLEARASAPLYLAHQCRPNSTTAHASRRVRRSKKVSVP 143 E GI AYTD LEARASAPLYLAHQCR NSTT HASRRVRRS KVSVP Sbjct: 10 EIGITAYTDGLEARASAPLYLAHQCRSNSTTTHASRRVRRSMKVSVP 56
BLAST of EsuBft936_16a-0001 vs. uniprot
Match: A0A6H5JES7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JES7_9PHAE) HSP 1 Score: 81.3 bits (199), Expect = 8.380e-17 Identity = 42/50 (84.00%), Postives = 43/50 (86.00%), Query Frame = 2 Query: 56 FVPGAPVPTQLHHCARLAAGAPQQEGIGPLRVSLALFARKTSPPPLGVCH 205 FVP APVPTQLHH ARLAAGAPQQEGIGPLRVSLAL ARKT PPL + H Sbjct: 29 FVPDAPVPTQLHHYARLAAGAPQQEGIGPLRVSLALLARKT--PPLAMGH 76
BLAST of EsuBft936_16a-0001 vs. uniprot
Match: A0A6H5KJ02_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJ02_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 2.430e-15 Identity = 39/47 (82.98%), Postives = 39/47 (82.98%), Query Frame = 3 Query: 3 EKGIAAYTDRLEARASAPLYLAHQCRPNSTTAHASRRVRRSKKVSVP 143 E GIAAY D LEARASAPLYL HQ RPNSTT HASRRVR SKKVS P Sbjct: 10 EMGIAAYNDGLEARASAPLYLTHQSRPNSTTTHASRRVRCSKKVSAP 56
BLAST of EsuBft936_16a-0001 vs. uniprot
Match: A0A6H5K2P0_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2P0_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 3.500e-14 Identity = 38/44 (86.36%), Postives = 38/44 (86.36%), Query Frame = 3 Query: 3 EKGIAAYTDRLEARASAPLYLAHQCRPNSTTAHASRRVRRSKKV 134 E GIAAYTD LEARASAPLYL HQCRPNS T HASRRVRRSKK Sbjct: 10 EMGIAAYTDGLEARASAPLYLTHQCRPNSNTTHASRRVRRSKKA 53
BLAST of EsuBft936_16a-0001 vs. uniprot
Match: A0A6H5K767_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K767_9PHAE) HSP 1 Score: 79.0 bits (193), Expect = 8.830e-14 Identity = 38/44 (86.36%), Postives = 38/44 (86.36%), Query Frame = 2 Query: 32 PGGPRICTFVPGAPVPTQLHHCARLAAGAPQQEGIGPLRVSLAL 163 P GPRICTFVP APVPTQLHH ARLAAGAPQQEGIGPLR S L Sbjct: 60 PTGPRICTFVPDAPVPTQLHHYARLAAGAPQQEGIGPLRYSQRL 103 The following BLAST results are available for this feature:
BLAST of EsuBft936_16a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
BLAST of EsuBft936_16a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 23 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft936_16 ID=EsuBft936_16|Name=EsuBft936_16a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=56bpback to top |