EsuBft509_3 (polypeptide) Ectocarpus subulatus male Bft15b
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5KN46_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KN46_9PHAE) HSP 1 Score: 87.0 bits (214), Expect = 1.060e-21 Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 0 Query: 1 MSLGIPNSSSSNLSSFRSFCFHPPSFFTILMDLYGNWTVATV 42 MSLGIPNSSSSNLSSFRSFCFHPPSFFTILMDLYGNWTVATV Sbjct: 1 MSLGIPNSSSSNLSSFRSFCFHPPSFFTILMDLYGNWTVATV 42
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5KLB6_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KLB6_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 4.070e-8 Identity = 25/31 (80.65%), Postives = 26/31 (83.87%), Query Frame = 0 Query: 1 MSLGIPNSSSSNLSSFRSFCFHPPSFFTILM 31 MSLGIPNS SSN F +FCFHPPSFFTILM Sbjct: 1 MSLGIPNSGSSNFPLFHTFCFHPPSFFTILM 31
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5KN46_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KN46_9PHAE) HSP 1 Score: 87.0 bits (214), Expect = 9.010e-18 Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 1 Query: 1 MSLGIPNSSSSNLSSFRSFCFHPPSFFTILMDLYGNWTVATV 126 MSLGIPNSSSSNLSSFRSFCFHPPSFFTILMDLYGNWTVATV Sbjct: 1 MSLGIPNSSSSNLSSFRSFCFHPPSFFTILMDLYGNWTVATV 42
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5KIB5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIB5_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 1.950e-6 Identity = 24/25 (96.00%), Postives = 24/25 (96.00%), Query Frame = -2 Query: 1420 LDLSGLALLAKRCKTRHPKYSPHSM 1494 LD SGLALLAKRCKTRHPKYSPHSM Sbjct: 19 LDFSGLALLAKRCKTRHPKYSPHSM 43
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5KS06_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KS06_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 2.040e-6 Identity = 28/30 (93.33%), Postives = 28/30 (93.33%), Query Frame = -3 Query: 3 MRMVKKLGGWKQKLRKEDKLELLLFGIPRD 92 MRMVKKLGGWKQKL K DKLELLLFGIPRD Sbjct: 1 MRMVKKLGGWKQKLWKGDKLELLLFGIPRD 30
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5KQZ6_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQZ6_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 3.030e-6 Identity = 23/25 (92.00%), Postives = 25/25 (100.00%), Query Frame = -2 Query: 1420 LDLSGLALLAKRCKTRHPKYSPHSM 1494 +DL+GLALLAKRCKTRHPKYSPHSM Sbjct: 3 MDLNGLALLAKRCKTRHPKYSPHSM 27
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5KVW2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KVW2_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 5.660e-6 Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = -2 Query: 430 MQVVPELIVVKMTSQEESSLYRGISEMMKWVVGG 531 MQV+PELIVVKMTS+E+ SLYRGISEM+ WVVGG Sbjct: 1 MQVIPELIVVKMTSREKRSLYRGISEMIIWVVGG 34
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5KPW8_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KPW8_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 6.050e-6 Identity = 24/30 (80.00%), Postives = 26/30 (86.67%), Query Frame = 3 Query: 780 FFNAVPIGISLR*ACAYFGLYPPHPLGEVE 869 + NAVPIGI+LR A A FGLYPPHPLGEVE Sbjct: 7 YLNAVPIGINLRQAYACFGLYPPHPLGEVE 36
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5KLB6_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KLB6_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 1.130e-5 Identity = 25/31 (80.65%), Postives = 26/31 (83.87%), Query Frame = 1 Query: 1 MSLGIPNSSSSNLSSFRSFCFHPPSFFTILM 93 MSLGIPNS SSN F +FCFHPPSFFTILM Sbjct: 1 MSLGIPNSGSSNFPLFHTFCFHPPSFFTILM 31
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5KI85_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KI85_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 1.170e-5 Identity = 22/24 (91.67%), Postives = 22/24 (91.67%), Query Frame = 1 Query: 1345 LHHSTCEVSVSYPHSTHPCVTRLW 1416 LHHSTCEV VS PHSTHPCVTRLW Sbjct: 53 LHHSTCEVFVSNPHSTHPCVTRLW 76
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5KS25_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KS25_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 3.530e-5 Identity = 22/24 (91.67%), Postives = 22/24 (91.67%), Query Frame = -2 Query: 1420 DLSGLALLAKRCKTRHPKYSPHSM 1491 DLSGLALLAKRCKT HPKYSPH M Sbjct: 10 DLSGLALLAKRCKTSHPKYSPHGM 33
BLAST of EsuBft509_3a-0001 vs. uniprot
Match: A0A6H5JU71_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JU71_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 3.650e-5 Identity = 27/30 (90.00%), Postives = 28/30 (93.33%), Query Frame = -3 Query: 3 MRMVKKLGGWKQKLRKEDKLELLLFGIPRD 92 MRMVKKLGGWKQKL K DKLELL+FGIPRD Sbjct: 1 MRMVKKLGGWKQKLWKGDKLELLMFGIPRD 30 The following BLAST results are available for this feature:
BLAST of EsuBft509_3a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
BLAST of EsuBft509_3a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 19 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft509_3 ID=EsuBft509_3|Name=EsuBft509_3a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=50bpback to top |