EsuBft3854_3 (polypeptide) Ectocarpus subulatus male Bft15b
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of EsuBft3854_3a-0001 vs. uniprot
Match: A0A6H5KEU7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KEU7_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 9.730e-10 Identity = 23/23 (100.00%), Postives = 23/23 (100.00%), Query Frame = 0 Query: 1 MEIGAAALCSGWYVRWEGQGNRE 23 MEIGAAALCSGWYVRWEGQGNRE Sbjct: 1 MEIGAAALCSGWYVRWEGQGNRE 23
BLAST of EsuBft3854_3a-0001 vs. uniprot
Match: A0A6H5L285_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L285_9PHAE) HSP 1 Score: 107 bits (268), Expect = 7.900e-24 Identity = 58/72 (80.56%), Postives = 63/72 (87.50%), Query Frame = -3 Query: 733 MYAYPPINQTRHARNGEARSTNIATHSSQECTPPTMQRSDTPNNMRPAYTT*SAMYTNPTQNKWDEHLGTAP 948 MYAYPPINQTRHARNGEARSTNIATHSSQECT PTMQRS T NNMRPAYTT +A+YTNPTQ +++G AP Sbjct: 1 MYAYPPINQTRHARNGEARSTNIATHSSQECTLPTMQRSGTSNNMRPAYTTRNAIYTNPTQ----KYMGRAP 68
BLAST of EsuBft3854_3a-0001 vs. uniprot
Match: A0A6H5K3G9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3G9_9PHAE) HSP 1 Score: 97.4 bits (241), Expect = 1.470e-20 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = -3 Query: 853 MYPDTRTPTYKPYNMYAYPPINQTRHARNGEARSTNIATHSSQECT 990 MYPDTRTPTYKPYNMYAYPPINQTRHARNGEARSTNIATHSSQECT Sbjct: 1 MYPDTRTPTYKPYNMYAYPPINQTRHARNGEARSTNIATHSSQECT 46
BLAST of EsuBft3854_3a-0001 vs. uniprot
Match: A0A6H5K5V9_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K5V9_9PHAE) HSP 1 Score: 78.2 bits (191), Expect = 2.630e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 2 Query: 497 FCFQSTRFAVFTGGEREHVCVWWPRVVFCCDVSIS 601 FCFQSTRFAVFTGGEREHVCVWWPRVVFC DVS + Sbjct: 308 FCFQSTRFAVFTGGEREHVCVWWPRVVFCRDVSAA 342
BLAST of EsuBft3854_3a-0001 vs. uniprot
Match: A0A6H5K6Y7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6Y7_9PHAE) HSP 1 Score: 64.7 bits (156), Expect = 1.270e-7 Identity = 33/50 (66.00%), Postives = 38/50 (76.00%), Query Frame = -3 Query: 2782 GGGVSR*MGVLIRACRVVRPLTSHPYKAGTEHAGFSPDQALTSPSEKLRK 2931 GGGV +++ VVRPLTSHPY+AGTEHAGFS DQALTSPS K R+ Sbjct: 183 GGGV-----LIVVHAVVVRPLTSHPYEAGTEHAGFSADQALTSPSAKRRE 227
BLAST of EsuBft3854_3a-0001 vs. uniprot
Match: A0A6H5KEU7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KEU7_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 2.460e-6 Identity = 23/23 (100.00%), Postives = 23/23 (100.00%), Query Frame = 1 Query: 1 MEIGAAALCSGWYVRWEGQGNRE 69 MEIGAAALCSGWYVRWEGQGNRE Sbjct: 1 MEIGAAALCSGWYVRWEGQGNRE 23
BLAST of EsuBft3854_3a-0001 vs. uniprot
Match: A0A6H5J7U0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J7U0_9PHAE) HSP 1 Score: 61.6 bits (148), Expect = 6.890e-6 Identity = 36/51 (70.59%), Postives = 37/51 (72.55%), Query Frame = -3 Query: 2782 GGGVSR*MGVLIRACRVV-RPLTSHPYKAGTEHAGFSPDQALTSPSEKLRK 2931 GGG GVLI VV RPLTSHP KAGTEHAGFS DQALTSPS K R+ Sbjct: 379 GGGAG---GVLIVVHAVVMRPLTSHPCKAGTEHAGFSLDQALTSPSAKRRE 426 The following BLAST results are available for this feature:
BLAST of EsuBft3854_3a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
BLAST of EsuBft3854_3a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 6 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft3854_3 ID=EsuBft3854_3|Name=EsuBft3854_3a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=23bpback to top |