EsuBft1750_2 (polypeptide) Ectocarpus subulatus male Bft15b
Overview
Homology
BLAST of EsuBft1750_2a-0001 vs. uniprot
Match: A0A6H5JPP2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPP2_9PHAE) HSP 1 Score: 107 bits (267), Expect = 9.100e-30 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0 Query: 1 MCKTDITRTRAPGAAEPVDVNRRTKQPPQHPLGGPKVRPRDARDARPLDCS 51 MCKTDITRTRAPGAAEPVDVNRRTKQPPQHPLGGPKVRPRDARDARPLDCS Sbjct: 1 MCKTDITRTRAPGAAEPVDVNRRTKQPPQHPLGGPKVRPRDARDARPLDCS 51
BLAST of EsuBft1750_2a-0001 vs. uniprot
Match: A0A6H5JPP2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPP2_9PHAE) HSP 1 Score: 107 bits (267), Expect = 2.410e-28 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 1 Query: 1 MCKTDITRTRAPGAAEPVDVNRRTKQPPQHPLGGPKVRPRDARDARPLDCS 153 MCKTDITRTRAPGAAEPVDVNRRTKQPPQHPLGGPKVRPRDARDARPLDCS Sbjct: 1 MCKTDITRTRAPGAAEPVDVNRRTKQPPQHPLGGPKVRPRDARDARPLDCS 51 The following BLAST results are available for this feature:
BLAST of EsuBft1750_2a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
BLAST of EsuBft1750_2a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft1750_2 ID=EsuBft1750_2|Name=EsuBft1750_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=51bpback to top |