EsuBft1467_5 (polypeptide) Ectocarpus subulatus male Bft15b
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5JMC8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMC8_9PHAE) HSP 1 Score: 99.0 bits (245), Expect = 1.710e-26 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 0 Query: 1 MLNYAHGLSATISDLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 48 MLNYAHGLSATISDLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT Sbjct: 1 MLNYAHGLSATISDLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 48
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5JCZ0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCZ0_9PHAE) HSP 1 Score: 67.0 bits (162), Expect = 9.920e-14 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 0 Query: 14 DLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 48 D +PVVTKVLEPSEDLKNTHTSD KKVCKSPKRYT Sbjct: 23 DSQPVVTKVLEPSEDLKNTHTSDMKKVCKSPKRYT 57
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5LDJ5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LDJ5_9PHAE) HSP 1 Score: 69.3 bits (168), Expect = 2.160e-13 Identity = 33/38 (86.84%), Postives = 35/38 (92.11%), Query Frame = 0 Query: 11 TISDLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 48 T ++PVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT Sbjct: 144 TKGHIQPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 181
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5KEB3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KEB3_9PHAE) HSP 1 Score: 69.7 bits (169), Expect = 1.100e-12 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 0 Query: 14 DLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 48 D +PVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT Sbjct: 560 DSQPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 594
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5KIP0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIP0_9PHAE) HSP 1 Score: 60.5 bits (145), Expect = 3.990e-11 Identity = 29/37 (78.38%), Postives = 32/37 (86.49%), Query Frame = 0 Query: 12 ISDLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 48 + D +PVVT VLEPSEDLKNTHT +EKKV KSPKRYT Sbjct: 10 VKDSQPVVTTVLEPSEDLKNTHTYNEKKVSKSPKRYT 46
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5L305_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L305_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 5.780e-11 Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 0 Query: 16 RPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 48 +PVVTKVLEPSEDLKNTHT +EKKV KSPKRYT Sbjct: 11 KPVVTKVLEPSEDLKNTHTYNEKKVPKSPKRYT 43
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5K4K3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K4K3_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 9.520e-11 Identity = 29/34 (85.29%), Postives = 31/34 (91.18%), Query Frame = 0 Query: 14 DLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRY 47 D +PVVTKVLEPSEDLKNTHT +EKKV KSPKRY Sbjct: 7 DSQPVVTKVLEPSEDLKNTHTYNEKKVSKSPKRY 40
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5JFU0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFU0_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 1.020e-10 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 0 Query: 16 RPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 48 +PVVTKVLEPSEDL+NTHT +EKKV KSPKRYT Sbjct: 21 KPVVTKVLEPSEDLRNTHTYNEKKVSKSPKRYT 53
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5L0T2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0T2_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 1.140e-10 Identity = 29/35 (82.86%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 14 DLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 48 D +PVVTKVLEPSEDLKNTHT +EK V KSPKRYT Sbjct: 12 DSQPVVTKVLEPSEDLKNTHTYNEKMVSKSPKRYT 46
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5LGB2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LGB2_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 3.780e-10 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 0 Query: 16 RPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRY 47 +PVVTKVLEPSEDLKNTHT +EKKV KSPKRY Sbjct: 31 QPVVTKVLEPSEDLKNTHTYNEKKVSKSPKRY 62
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5JDD8_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JDD8_9PHAE) HSP 1 Score: 143 bits (360), Expect = 8.850e-43 Identity = 68/70 (97.14%), Postives = 68/70 (97.14%), Query Frame = -2 Query: 88 RQHFRQHYAVVGNLPFWYRVGQGGGDATVVERWDGRAVQFLGTHTVLQGFLGVPLRALAYLFLVRCVRVL 297 RQHFRQ YAVVGNLPFWYRVGQGGGDATVVERWDGRAVQFLGTHTVLQGFLGVPLRAL YLFLVRCVRVL Sbjct: 9 RQHFRQQYAVVGNLPFWYRVGQGGGDATVVERWDGRAVQFLGTHTVLQGFLGVPLRALGYLFLVRCVRVL 78
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5KBR8_9PHAE (Uncharacterized protein (Fragment) n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KBR8_9PHAE) HSP 1 Score: 111 bits (277), Expect = 2.380e-30 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = -2 Query: 148 RQHFRQHYAVVGNLPFWYRVGQGGGDATVVERWDGRAVQFLGTHTVLQGF 297 RQHFRQHYAVVGNLPFWYRVGQGGGDATVVERWDGRAVQFLGTHTVLQGF Sbjct: 9 RQHFRQHYAVVGNLPFWYRVGQGGGDATVVERWDGRAVQFLGTHTVLQGF 58
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5JMC8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMC8_9PHAE) HSP 1 Score: 99.8 bits (247), Expect = 6.810e-26 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 1 Query: 1 MLNYAHGLSATISDLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 144 MLNYAHGLSATISDLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT Sbjct: 1 MLNYAHGLSATISDLRPVVTKVLEPSEDLKNTHTSDEKKVCKSPKRYT 48
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5JWK2_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWK2_9PHAE) HSP 1 Score: 94.4 bits (233), Expect = 7.970e-23 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 160 HRMRAQKLNCTSVPPFDYSSITPSLSHSIPKRKIADYSIMLSEVLS 297 HRMRAQKLNCTSVPPFDYSSITPSLSHS+PKRKIADYSIMLSEVLS Sbjct: 4 HRMRAQKLNCTSVPPFDYSSITPSLSHSLPKRKIADYSIMLSEVLS 49
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5JHD2_9PHAE (Uncharacterized protein n=4 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHD2_9PHAE) HSP 1 Score: 89.0 bits (219), Expect = 1.510e-21 Identity = 43/44 (97.73%), Postives = 44/44 (100.00%), Query Frame = 1 Query: 166 MRAQKLNCTSVPPFDYSSITPSLSHSIPKRKIADYSIMLSEVLS 297 MRAQKLNCTSVPPFDYSSITPSLSHSIPKRKIADYSI+LSEVLS Sbjct: 1 MRAQKLNCTSVPPFDYSSITPSLSHSIPKRKIADYSILLSEVLS 44
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5JUS8_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUS8_9PHAE) HSP 1 Score: 87.4 bits (215), Expect = 1.320e-20 Identity = 42/44 (95.45%), Postives = 43/44 (97.73%), Query Frame = 1 Query: 166 MRAQKLNCTSVPPFDYSSITPSLSHSIPKRKIADYSIMLSEVLS 297 MR QKLNCTSVPPFDYSSITPSLSHSIPKRKIADYSI+LSEVLS Sbjct: 1 MRTQKLNCTSVPPFDYSSITPSLSHSIPKRKIADYSILLSEVLS 44
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5KV15_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KV15_9PHAE) HSP 1 Score: 85.9 bits (211), Expect = 2.030e-20 Identity = 41/44 (93.18%), Postives = 42/44 (95.45%), Query Frame = 1 Query: 166 MRAQKLNCTSVPPFDYSSITPSLSHSIPKRKIADYSIMLSEVLS 297 M AQKLNCTSVPPFDYSSITPSLSHS+PKRKIADY IMLSEVLS Sbjct: 1 MHAQKLNCTSVPPFDYSSITPSLSHSLPKRKIADYGIMLSEVLS 44
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5KSV2_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KSV2_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 2.590e-20 Identity = 41/44 (93.18%), Postives = 43/44 (97.73%), Query Frame = 1 Query: 166 MRAQKLNCTSVPPFDYSSITPSLSHSIPKRKIADYSIMLSEVLS 297 MRA KLNCTSVPPFDYSSITPSLSHS+PKRKIADYSI+LSEVLS Sbjct: 1 MRASKLNCTSVPPFDYSSITPSLSHSLPKRKIADYSILLSEVLS 44
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5KVY0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KVY0_9PHAE) HSP 1 Score: 84.7 bits (208), Expect = 7.150e-20 Identity = 41/44 (93.18%), Postives = 42/44 (95.45%), Query Frame = 1 Query: 166 MRAQKLNCTSVPPFDYSSITPSLSHSIPKRKIADYSIMLSEVLS 297 MRAQKLNCTSVPP DY SITPSLSHSIPKRKIADYSI+LSEVLS Sbjct: 1 MRAQKLNCTSVPPLDYRSITPSLSHSIPKRKIADYSILLSEVLS 44
BLAST of EsuBft1467_5a-0001 vs. uniprot
Match: A0A6H5JYW7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYW7_9PHAE) HSP 1 Score: 84.3 bits (207), Expect = 1.040e-19 Identity = 40/44 (90.91%), Postives = 42/44 (95.45%), Query Frame = 1 Query: 166 MRAQKLNCTSVPPFDYSSITPSLSHSIPKRKIADYSIMLSEVLS 297 MRAQKLNC SVPPFDYSSITP LSHSIPKRKIADYSI++SEVLS Sbjct: 1 MRAQKLNCASVPPFDYSSITPCLSHSIPKRKIADYSILMSEVLS 44 The following BLAST results are available for this feature:
BLAST of EsuBft1467_5a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 18 ZOOMx 1POSITION0
Pagesback to top
BLAST of EsuBft1467_5a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft1467_5 ID=EsuBft1467_5|Name=EsuBft1467_5a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=48bpback to top |