EsuBft1044_3 (polypeptide) Ectocarpus subulatus male Bft15b
Overview
Homology
BLAST of EsuBft1044_3a-0001 vs. uniprot
Match: A0A6H5J8Y6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J8Y6_9PHAE) HSP 1 Score: 100 bits (249), Expect = 5.100e-27 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0 Query: 1 MTKTSGREGRPAMYLARSMSRSQRFPKLALEGRPATIPRPMVKSTPQIQFS 51 MTKTSGREGRPAMYLARSMSRSQRFPKLALEGRPATIPRPMVKSTPQIQFS Sbjct: 1 MTKTSGREGRPAMYLARSMSRSQRFPKLALEGRPATIPRPMVKSTPQIQFS 51
BLAST of EsuBft1044_3a-0001 vs. uniprot
Match: A0A6H5J8Y6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J8Y6_9PHAE) HSP 1 Score: 102 bits (254), Expect = 1.550e-25 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 1 Query: 55 MTKTSGREGRPAMYLARSMSRSQRFPKLALEGRPATIPRPMVKSTPQIQFS 207 MTKTSGREGRPAMYLARSMSRSQRFPKLALEGRPATIPRPMVKSTPQIQFS Sbjct: 1 MTKTSGREGRPAMYLARSMSRSQRFPKLALEGRPATIPRPMVKSTPQIQFS 51 The following BLAST results are available for this feature:
BLAST of EsuBft1044_3a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
BLAST of EsuBft1044_3a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft1044_3 ID=EsuBft1044_3|Name=EsuBft1044_3a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=51bpback to top |