EsuBft1013_8 (polypeptide) Ectocarpus subulatus male Bft15b
Overview
Homology
BLAST of EsuBft1013_8a-0001 vs. uniprot
Match: A0A6H5J7T5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J7T5_9PHAE) HSP 1 Score: 100 bits (249), Expect = 3.020e-27 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0 Query: 1 MKCWCGTTDDYTRYGTGTCNFSCSGDNEQTCGGRESANVWTVD 43 MKCWCGTTDDYTRYGTGTCNFSCSGDNEQTCGGRESANVWTVD Sbjct: 1 MKCWCGTTDDYTRYGTGTCNFSCSGDNEQTCGGRESANVWTVD 43
BLAST of EsuBft1013_8a-0001 vs. uniprot
Match: D7FRT2_ECTSI (EsV-1-164 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FRT2_ECTSI) HSP 1 Score: 94.7 bits (234), Expect = 1.390e-21 Identity = 40/42 (95.24%), Postives = 42/42 (100.00%), Query Frame = 0 Query: 2 KCWCGTTDDYTRYGTGTCNFSCSGDNEQTCGGRESANVWTVD 43 +CWCGTTDDYTRYGTGTCNFSCSGD+EQTCGGRESANVWTVD Sbjct: 658 QCWCGTTDDYTRYGTGTCNFSCSGDSEQTCGGRESANVWTVD 699
BLAST of EsuBft1013_8a-0001 vs. uniprot
Match: A0A6H5J7T5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J7T5_9PHAE) HSP 1 Score: 102 bits (255), Expect = 6.120e-23 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 1 Query: 1 MKCWCGTTDDYTRYGTGTCNFSCSGDNEQTCGGRESANVWTVD 129 MKCWCGTTDDYTRYGTGTCNFSCSGDNEQTCGGRESANVWTVD Sbjct: 1 MKCWCGTTDDYTRYGTGTCNFSCSGDNEQTCGGRESANVWTVD 43
BLAST of EsuBft1013_8a-0001 vs. uniprot
Match: D7FRT2_ECTSI (EsV-1-164 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FRT2_ECTSI) HSP 1 Score: 97.1 bits (240), Expect = 1.100e-16 Identity = 40/42 (95.24%), Postives = 42/42 (100.00%), Query Frame = 1 Query: 4 KCWCGTTDDYTRYGTGTCNFSCSGDNEQTCGGRESANVWTVD 129 +CWCGTTDDYTRYGTGTCNFSCSGD+EQTCGGRESANVWTVD Sbjct: 658 QCWCGTTDDYTRYGTGTCNFSCSGDSEQTCGGRESANVWTVD 699 The following BLAST results are available for this feature:
BLAST of EsuBft1013_8a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
BLAST of EsuBft1013_8a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft1013_8 ID=EsuBft1013_8|Name=EsuBft1013_8a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=43bpback to top |