EsuBft2263_5a-0001 (mRNA) Ectocarpus subulatus male Bft15b
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >EsuBft2263_5a-0001 ID=EsuBft2263_5a-0001|Name=EsuBft2263_5a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=445bp|location=Sequence derived from alignment at Scaffold_548:18496..18940+ (Ectocarpus subulatus male Bft15b)|Notes=Excludes all bases but those of type(s): exon. ATGTTTGTCCGTGCGCCACGGGTCGATGTCGCCCGCATGCTCCGGTGCCGback to top protein sequence of EsuBft2263_5a-0001 >EsuBft2263_5 ID=EsuBft2263_5|Name=EsuBft2263_5a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=100bp MFVRAPRVDVARMLRCRCSIRRRCSQPEQNATRPAPFVHALVAVLPSRFRback to top mRNA from alignment at Scaffold_548:18496..18940+ Legend: exonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>EsuBft2263_5a-0001 ID=EsuBft2263_5a-0001|Name=EsuBft2263_5a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=445bp|location=Sequence derived from alignment at Scaffold_548:18496..18940+ (Ectocarpus subulatus male Bft15b)back to top Coding sequence (CDS) from alignment at Scaffold_548:18496..18940+ >EsuBft2263_5a-0001 ID=EsuBft2263_5a-0001|Name=EsuBft2263_5a-0001|organism=Ectocarpus subulatus male Bft15b|type=CDS|length=303bp|location=Sequence derived from alignment at Scaffold_548:18496..18940+ (Ectocarpus subulatus male Bft15b)back to top |