Ec-28_002500.1 (polypeptide) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-28_002500.1 vs. uniprot
Match: D7FXP4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FXP4_ECTSI) HSP 1 Score: 69.3 bits (168), Expect = 4.230e-15 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 0 Query: 1 MIAASRALESRRRDRLFDDPYAELLLNNVLATRY 34 MIAASRALESRRRDRLFDDPYAELLLNNVLATRY Sbjct: 1 MIAASRALESRRRDRLFDDPYAELLLNNVLATRY 34
BLAST of Ec-28_002500.1 vs. uniprot
Match: D8LGT9_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LGT9_ECTSI) HSP 1 Score: 50.4 bits (119), Expect = 3.790e-6 Identity = 24/25 (96.00%), Postives = 25/25 (100.00%), Query Frame = 0 Query: 1 MIAASRALESRRRDRLFDDPYAELL 25 MIAA+RALESRRRDRLFDDPYAELL Sbjct: 86 MIAAARALESRRRDRLFDDPYAELL 110 The following BLAST results are available for this feature:
BLAST of Ec-28_002500.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ec-28_002500.1 ID=Ec-28_002500.1|Name=Ec-28_002500.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=35bpback to top |