Ec-00_003830.1 (polypeptide) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_003830.1 vs. uniprot
Match: A0A6H5JDB2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JDB2_9PHAE) HSP 1 Score: 96.3 bits (238), Expect = 2.900e-23 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0 Query: 61 TKNPKCNEGESEEPTGKDSNESVYEAERVEFGRARTGHSGTGEAAPEQRHRSS 113 TKNPKC+EGESEEPTGKDSNESVYEAERVEFGRARTGHSGTG AAPEQRHRSS Sbjct: 23 TKNPKCDEGESEEPTGKDSNESVYEAERVEFGRARTGHSGTGAAAPEQRHRSS 75
BLAST of Ec-00_003830.1 vs. uniprot
Match: A0A6H5JVG2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JVG2_9PHAE) HSP 1 Score: 92.8 bits (229), Expect = 5.040e-22 Identity = 49/53 (92.45%), Postives = 51/53 (96.23%), Query Frame = 0 Query: 60 RTKNPKCNEGESEEPTGKDSNESVYEAERVEFGRARTGHSGTGEAAPEQRHRS 112 +T+NPKCNEGESEEPT KDSNESVYEAERVEFGRARTGHSGTG AAPEQRHRS Sbjct: 20 QTENPKCNEGESEEPTEKDSNESVYEAERVEFGRARTGHSGTGAAAPEQRHRS 72
BLAST of Ec-00_003830.1 vs. uniprot
Match: A0A6H5L5T9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L5T9_9PHAE) HSP 1 Score: 90.9 bits (224), Expect = 3.040e-21 Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = 0 Query: 60 RTKNPKCNEGESEEPTGKDSNESVYEAERVEFGRARTGHSGTGEAAPEQRHRS 112 +TKNPKCNEGESEEPTGKD NESVYEAERVEFGRARTG+SGTG AAPEQR+RS Sbjct: 21 QTKNPKCNEGESEEPTGKDGNESVYEAERVEFGRARTGYSGTGAAAPEQRNRS 73
BLAST of Ec-00_003830.1 vs. uniprot
Match: A0A6H5L5E7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L5E7_9PHAE) HSP 1 Score: 88.2 bits (217), Expect = 1.960e-20 Identity = 45/50 (90.00%), Postives = 48/50 (96.00%), Query Frame = 0 Query: 61 TKNPKCNEGESEEPTGKDSNESVYEAERVEFGRARTGHSGTGEAAPEQRH 110 TKNPKCNEG+SE+PTGKD NE+VYEAERVEFGRARTGHSGTG AAPEQRH Sbjct: 2 TKNPKCNEGKSEKPTGKDGNENVYEAERVEFGRARTGHSGTGAAAPEQRH 51
BLAST of Ec-00_003830.1 vs. uniprot
Match: A0A6H5KV64_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KV64_9PHAE) HSP 1 Score: 89.4 bits (220), Expect = 4.450e-20 Identity = 48/52 (92.31%), Postives = 49/52 (94.23%), Query Frame = 0 Query: 61 TKNPKCNEGESEEPTGKDSNESVYEAERVEFGRARTGHSGTGEAAPEQRHRS 112 TKNP CNEGESEEPTG DSNESVYEAERVEFGRARTGHSGTG AAPEQR+RS Sbjct: 64 TKNPMCNEGESEEPTGMDSNESVYEAERVEFGRARTGHSGTGGAAPEQRNRS 115
BLAST of Ec-00_003830.1 vs. uniprot
Match: A0A6H5JFY1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFY1_9PHAE) HSP 1 Score: 87.0 bits (214), Expect = 1.260e-19 Identity = 46/53 (86.79%), Postives = 50/53 (94.34%), Query Frame = 0 Query: 60 RTKNPKCNEGESEEPTGKDSNESVYEAERVEFGRARTGHSGTGEAAPEQRHRS 112 +T+NPKC+EGESEEPTGKDSNESVYEAERVEFGRAR HSGTG AAPEQR+RS Sbjct: 22 QTENPKCDEGESEEPTGKDSNESVYEAERVEFGRARVSHSGTGAAAPEQRNRS 74
BLAST of Ec-00_003830.1 vs. uniprot
Match: A0A6H5KRF1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRF1_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 2.090e-19 Identity = 46/53 (86.79%), Postives = 49/53 (92.45%), Query Frame = 0 Query: 61 TKNPKCNEGESEEPTGKDSNESVYEAERVEFGRARTGHSGTGEAAPEQRHRSS 113 T+NP CNEGESEEPTGKDSNESVYEAERVEFGRARTGHSGTG APE+R+ SS Sbjct: 28 TQNPTCNEGESEEPTGKDSNESVYEAERVEFGRARTGHSGTGAVAPEERNPSS 80
BLAST of Ec-00_003830.1 vs. uniprot
Match: A0A6H5KW85_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KW85_9PHAE) HSP 1 Score: 77.8 bits (190), Expect = 4.140e-16 Identity = 41/47 (87.23%), Postives = 43/47 (91.49%), Query Frame = 0 Query: 66 CNEGESEEPTGKDSNESVYEAERVEFGRARTGHSGTGEAAPEQRHRS 112 CNEGESEEP G+DSNESVYEAERVEFGR RT HSGTG AAPEQR+RS Sbjct: 2 CNEGESEEPAGEDSNESVYEAERVEFGRCRTSHSGTGAAAPEQRNRS 48
BLAST of Ec-00_003830.1 vs. uniprot
Match: A0A6H5K119_9PHAE (Integrase catalytic domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K119_9PHAE) HSP 1 Score: 80.5 bits (197), Expect = 5.370e-15 Identity = 43/45 (95.56%), Postives = 43/45 (95.56%), Query Frame = 0 Query: 68 EGESEEPTGKDSNESVYEAERVEFGRARTGHSGTGEAAPEQRHRS 112 EGESEEPTGKDSNESVYEAER EFGRARTGHSGTG AAPEQRHRS Sbjct: 117 EGESEEPTGKDSNESVYEAERFEFGRARTGHSGTGAAAPEQRHRS 161
BLAST of Ec-00_003830.1 vs. uniprot
Match: A0A6H5JHY2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHY2_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 4.100e-12 Identity = 35/36 (97.22%), Postives = 35/36 (97.22%), Query Frame = 0 Query: 78 DSNESVYEAERVEFGRARTGHSGTGEAAPEQRHRSS 113 DSNESVYEAERVEFGRARTGHSGTG AAPEQRHRSS Sbjct: 2 DSNESVYEAERVEFGRARTGHSGTGAAAPEQRHRSS 37 The following BLAST results are available for this feature:
BLAST of Ec-00_003830.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 15
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ec-00_003830.1 ID=Ec-00_003830.1|Name=Ec-00_003830.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=136bpback to top |