Ec-00_004360.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_004360.1 vs. uniprot
Match: D7FZ24_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZ24_ECTSI) HSP 1 Score: 112 bits (280), Expect = 1.380e-31 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 1 Query: 1 MRARASGRERSAEKYTSVLLHTQQLSPPVGHERSRRQGGGHRQGRRRVDRWSRCGQ 168 MRARASGRERSAEKYTSVLLHTQQLSPPVGHERSRRQGGGHRQGRRRVDRWSRCGQ Sbjct: 1 MRARASGRERSAEKYTSVLLHTQQLSPPVGHERSRRQGGGHRQGRRRVDRWSRCGQ 56
BLAST of Ec-00_004360.1 vs. uniprot
Match: A0A6H5K6G6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6G6_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 6.750e-9 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 1 Query: 64 TQQLSPPVGHERSRRQGGGHRQGRRRVDRWSRCGQ 168 TQQLSPP+GHE RQ GHRQG RRV+ WSRCGQ Sbjct: 17 TQQLSPPIGHEGCPRQDAGHRQGHRRVNAWSRCGQ 51
BLAST of Ec-00_004360.1 vs. uniprot
Match: A0A6H5K6B0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6B0_9PHAE) HSP 1 Score: 51.6 bits (122), Expect = 2.890e-6 Identity = 23/33 (69.70%), Postives = 28/33 (84.85%), Query Frame = 1 Query: 67 QQLSPPVGHERSRRQGGGHRQGRRRVDRWSRCG 165 QQ SPP+GH+ S R+ GGHRQGRR+VD WS+CG Sbjct: 2 QQQSPPIGHQGSPRERGGHRQGRRKVDGWSQCG 34 The following BLAST results are available for this feature:
BLAST of Ec-00_004360.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_004360.1 ID=Ec-00_004360.1|Name=Ec-00_004360.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=57bpback to top spliced messenger RNA >Ec-00_004360.1 ID=Ec-00_004360.1|Name=Ec-00_004360.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=171bp|location=Sequence derived from alignment at chr_00:5802411..5802581- (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGAGAGCGAGAGCGAGCGGGAGAGAGAGAAGTGCAGAGAAATACACCAGback to top protein sequence of Ec-00_004360.1 >Ec-00_004360.1 ID=Ec-00_004360.1|Name=Ec-00_004360.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=57bp MRARASGRERSAEKYTSVLLHTQQLSPPVGHERSRRQGGGHRQGRRRVDRback to top mRNA from alignment at chr_00:5802411..5802581- Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_004360.1 ID=Ec-00_004360.1|Name=Ec-00_004360.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=171bp|location=Sequence derived from alignment at chr_00:5802411..5802581- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:5802411..5802581- >Ec-00_004360.1 ID=Ec-00_004360.1|Name=Ec-00_004360.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=171bp|location=Sequence derived from alignment at chr_00:5802411..5802581- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_004360.1' has the following synonyms
|