Ec-00_000120.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_000120.1 vs. uniprot
Match: A0A6H5KRY1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRY1_9PHAE) HSP 1 Score: 144 bits (363), Expect = 2.720e-38 Identity = 66/69 (95.65%), Postives = 68/69 (98.55%), Query Frame = 1 Query: 121 QDGHLWIPVSVNKFDNLETDPLVKMCQVNYDSYSEAPWLLPMGGLLSISSGCADLKRDTVQIVHMSTLK 327 +DGHLWIPVSVNKFDNLETDPLVKMCQVNYDSYS APWLLPMGGLLSI+SGCADLKRDTVQIVHMSTLK Sbjct: 193 KDGHLWIPVSVNKFDNLETDPLVKMCQVNYDSYSAAPWLLPMGGLLSIASGCADLKRDTVQIVHMSTLK 261 The following BLAST results are available for this feature:
BLAST of Ec-00_000120.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_000120.1 ID=Ec-00_000120.1|Name=Ec-00_000120.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=119bpback to top spliced messenger RNA >Ec-00_000120.1 ID=Ec-00_000120.1|Name=Ec-00_000120.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=357bp|location=Sequence derived from alignment at chr_00:160712..162013- (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGCATACCATACACGTGCCAAACGAACGTGTTTCATGTCTCAGCCTTAAback to top protein sequence of Ec-00_000120.1 >Ec-00_000120.1 ID=Ec-00_000120.1|Name=Ec-00_000120.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=119bp MHTIHVPNERVSCLSLNRAVAVCVHALPYWRTLIHSFFPRQDGHLWIPVSback to top mRNA from alignment at chr_00:160712..162013- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_000120.1 ID=Ec-00_000120.1|Name=Ec-00_000120.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=1302bp|location=Sequence derived from alignment at chr_00:160712..162013- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:160712..162013- >Ec-00_000120.1 ID=Ec-00_000120.1|Name=Ec-00_000120.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=357bp|location=Sequence derived from alignment at chr_00:160712..162013- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_000120.1' has the following synonyms
|