mRNA_Ecto-sp6_S_contig102.844.1 (mRNA) Ectocarpus species6 EcLAC_371
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp6_S_contig102.844.1 vs. uniprot
Match: D7FHF4_ECTSI (Ankyrin n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHF4_ECTSI) HSP 1 Score: 99.0 bits (245), Expect = 2.160e-22 Identity = 49/50 (98.00%), Postives = 50/50 (100.00%), Query Frame = 1 Query: 52 AEAKEVDLLRKLAVGLHPVLLVEPLTTVREVTKWYTVQLEKSFKSYRHRR 201 AEAKEVDLLRKLAVGLHPVLLVEPLTTVREVTKWYTVQLEKSFKSYRHR+ Sbjct: 1129 AEAKEVDLLRKLAVGLHPVLLVEPLTTVREVTKWYTVQLEKSFKSYRHRK 1178
BLAST of mRNA_Ecto-sp6_S_contig102.844.1 vs. uniprot
Match: A0A6H5K1B4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K1B4_9PHAE) HSP 1 Score: 78.2 bits (191), Expect = 4.330e-15 Identity = 39/40 (97.50%), Postives = 39/40 (97.50%), Query Frame = 1 Query: 52 AEAKEVDLLRKLAVGLHPVLLVEPLTTVREVTKWYTVQLE 171 AEAKEVDLLRKLAVGLHPVLLVEPLTTVREVTKWYTVQ E Sbjct: 893 AEAKEVDLLRKLAVGLHPVLLVEPLTTVREVTKWYTVQEE 932 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig102.844.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp6_S_contig102.844.1 >prot_Ecto-sp6_S_contig102.844.1 ID=prot_Ecto-sp6_S_contig102.844.1|Name=mRNA_Ecto-sp6_S_contig102.844.1|organism=Ectocarpus species6 EcLAC_371|type=polypeptide|length=79bp AAVREAEAEAEAEARERAEAKEVDLLRKLAVGLHPVLLVEPLTTVREVTKback to top mRNA from alignment at Ecto-sp6_S_contig102:184941..185576+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp6_S_contig102.844.1 ID=mRNA_Ecto-sp6_S_contig102.844.1|Name=mRNA_Ecto-sp6_S_contig102.844.1|organism=Ectocarpus species6 EcLAC_371|type=mRNA|length=636bp|location=Sequence derived from alignment at Ecto-sp6_S_contig102:184941..185576+ (Ectocarpus species6 EcLAC_371)back to top Coding sequence (CDS) from alignment at Ecto-sp6_S_contig102:184941..185576+ >mRNA_Ecto-sp6_S_contig102.844.1 ID=mRNA_Ecto-sp6_S_contig102.844.1|Name=mRNA_Ecto-sp6_S_contig102.844.1|organism=Ectocarpus species6 EcLAC_371|type=CDS|length=237bp|location=Sequence derived from alignment at Ecto-sp6_S_contig102:184941..185576+ (Ectocarpus species6 EcLAC_371)back to top |