mRNA_Ecto-sp6_S_contig101.822.1 (mRNA) Ectocarpus species6 EcLAC_371
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp6_S_contig101.822.1 vs. uniprot
Match: A0A6H5JJF2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJF2_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 3.520e-7 Identity = 27/37 (72.97%), Postives = 29/37 (78.38%), Query Frame = -2 Query: 3 VGRSGGNVAIEGKVRIRRVPSSLDSEGFTRRVDAFFH 113 VGRS G VAIE KVRI RVPS+LD E TRRVD+ FH Sbjct: 67 VGRSSGAVAIEEKVRIPRVPSTLDPERVTRRVDSPFH 103
BLAST of mRNA_Ecto-sp6_S_contig101.822.1 vs. uniprot
Match: D8LMZ0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LMZ0_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 8.470e-7 Identity = 27/37 (72.97%), Postives = 29/37 (78.38%), Query Frame = -2 Query: 3 VGRSGGNVAIEGKVRIRRVPSSLDSEGFTRRVDAFFH 113 VGRS G VAIE KVRI RVPS+LD EG TRRVD+ H Sbjct: 66 VGRSNGAVAIEEKVRIPRVPSALDPEGITRRVDSPLH 102
BLAST of mRNA_Ecto-sp6_S_contig101.822.1 vs. uniprot
Match: D8LMZ8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LMZ8_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 8.620e-7 Identity = 27/37 (72.97%), Postives = 29/37 (78.38%), Query Frame = -2 Query: 3 VGRSGGNVAIEGKVRIRRVPSSLDSEGFTRRVDAFFH 113 VGRS G VAIE KVRI RVPS+LD EG TRRVD+ H Sbjct: 66 VGRSSGAVAIEEKVRIPRVPSALDPEGITRRVDSPLH 102
BLAST of mRNA_Ecto-sp6_S_contig101.822.1 vs. uniprot
Match: A0A6H5JPB1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPB1_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 1.320e-6 Identity = 26/37 (70.27%), Postives = 29/37 (78.38%), Query Frame = -2 Query: 3 VGRSGGNVAIEGKVRIRRVPSSLDSEGFTRRVDAFFH 113 VGRS G VAIE K+RI RVPS+LD EG TRRVD+ H Sbjct: 68 VGRSSGAVAIEEKLRIPRVPSALDPEGITRRVDSPLH 104 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig101.822.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp6_S_contig101.822.1 >prot_Ecto-sp6_S_contig101.822.1 ID=prot_Ecto-sp6_S_contig101.822.1|Name=mRNA_Ecto-sp6_S_contig101.822.1|organism=Ectocarpus species6 EcLAC_371|type=polypeptide|length=59bp MWKKASTLRVNPSESSEEGTRRMRTFPSMATLPPLRPTNASHGILPGNIRback to top mRNA from alignment at Ecto-sp6_S_contig101:591970..592146- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp6_S_contig101.822.1 ID=mRNA_Ecto-sp6_S_contig101.822.1|Name=mRNA_Ecto-sp6_S_contig101.822.1|organism=Ectocarpus species6 EcLAC_371|type=mRNA|length=177bp|location=Sequence derived from alignment at Ecto-sp6_S_contig101:591970..592146- (Ectocarpus species6 EcLAC_371)back to top Coding sequence (CDS) from alignment at Ecto-sp6_S_contig101:591970..592146- >mRNA_Ecto-sp6_S_contig101.822.1 ID=mRNA_Ecto-sp6_S_contig101.822.1|Name=mRNA_Ecto-sp6_S_contig101.822.1|organism=Ectocarpus species6 EcLAC_371|type=CDS|length=177bp|location=Sequence derived from alignment at Ecto-sp6_S_contig101:591970..592146- (Ectocarpus species6 EcLAC_371)back to top |