mRNA_Ecto-sp6_S_contig100.705.1 (mRNA) Ectocarpus species6 EcLAC_371
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp6_S_contig100.705.1 vs. uniprot
Match: D7FK37_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FK37_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 9.840e-10 Identity = 26/26 (100.00%), Postives = 26/26 (100.00%), Query Frame = 3 Query: 150 MEVGQRSPMGRYPSTGSQVGFGTTKH 227 MEVGQRSPMGRYPSTGSQVGFGTTKH Sbjct: 1 MEVGQRSPMGRYPSTGSQVGFGTTKH 26
BLAST of mRNA_Ecto-sp6_S_contig100.705.1 vs. uniprot
Match: A0A6H5JGM7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JGM7_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 1.160e-8 Identity = 21/33 (63.64%), Postives = 25/33 (75.76%), Query Frame = 1 Query: 1 VGSGWRHDRDLQQNPLRVGECICSRTDCVLGLY 99 VG GW H+RDL +PL+ GECIC R DCV+ LY Sbjct: 62 VGEGWTHERDLVGDPLKAGECICRRADCVVNLY 94
BLAST of mRNA_Ecto-sp6_S_contig100.705.1 vs. uniprot
Match: A0A6H5KE39_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KE39_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 2.660e-7 Identity = 20/32 (62.50%), Postives = 25/32 (78.12%), Query Frame = 1 Query: 1 VGSGWRHDRDLQQNPLRVGECICSRTDCVLGL 96 VG W H+RDLQ +PL+VGECIC+R DC G+ Sbjct: 61 VGQEWPHERDLQGDPLKVGECICTRPDCAGGI 92 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig100.705.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp6_S_contig100.705.1 >prot_Ecto-sp6_S_contig100.705.1 ID=prot_Ecto-sp6_S_contig100.705.1|Name=mRNA_Ecto-sp6_S_contig100.705.1|organism=Ectocarpus species6 EcLAC_371|type=polypeptide|length=83bp VGSGWRHDRDLQQNPLRVGECICSRTDCVLGLYNSTCGGARGKKKDLCTKback to top mRNA from alignment at Ecto-sp6_S_contig100:177801..179099+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp6_S_contig100.705.1 ID=mRNA_Ecto-sp6_S_contig100.705.1|Name=mRNA_Ecto-sp6_S_contig100.705.1|organism=Ectocarpus species6 EcLAC_371|type=mRNA|length=1299bp|location=Sequence derived from alignment at Ecto-sp6_S_contig100:177801..179099+ (Ectocarpus species6 EcLAC_371)back to top Coding sequence (CDS) from alignment at Ecto-sp6_S_contig100:177801..179099+ >mRNA_Ecto-sp6_S_contig100.705.1 ID=mRNA_Ecto-sp6_S_contig100.705.1|Name=mRNA_Ecto-sp6_S_contig100.705.1|organism=Ectocarpus species6 EcLAC_371|type=CDS|length=249bp|location=Sequence derived from alignment at Ecto-sp6_S_contig100:177801..179099+ (Ectocarpus species6 EcLAC_371)back to top |