prot_Ecto-sp13_S_contig99528.21600.1 (polypeptide) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A6H5KGX1_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KGX1_9PHAE) HSP 1 Score: 105 bits (263), Expect = 8.660e-27 Identity = 47/48 (97.92%), Postives = 48/48 (100.00%), Query Frame = 0 Query: 1 PYFTQQAGKARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 48 PYFTQQAGKARWTLSEAEDTRGAGLWVWGLFK+PLYPFLLLQVNNLEI Sbjct: 153 PYFTQQAGKARWTLSEAEDTRGAGLWVWGLFKEPLYPFLLLQVNNLEI 200
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S2IJE4_9STRA (Hypothetical protein n=2 Tax=Helicotheca tamesis TaxID=374047 RepID=A0A7S2IJE4_9STRA) HSP 1 Score: 63.2 bits (152), Expect = 1.570e-11 Identity = 27/40 (67.50%), Postives = 31/40 (77.50%), Query Frame = 0 Query: 9 KARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 48 K+RW LSE D R GLWVWGLFK+PLYPF+LLQ+ EI Sbjct: 12 KSRWILSEDPDDRKDGLWVWGLFKEPLYPFMLLQLETEEI 51
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S4SSA2_9STRA (Hypothetical protein n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S4SSA2_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 3.370e-10 Identity = 26/40 (65.00%), Postives = 32/40 (80.00%), Query Frame = 0 Query: 9 KARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 48 K+RW LSE + R GLWVWGLFK+PLYPF+LLQ+ + EI Sbjct: 110 KSRWILSEDPNERKDGLWVWGLFKEPLYPFMLLQLESEEI 149
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S0T816_9STRA (Hypothetical protein n=1 Tax=Pseudo-nitzschia delicatissima TaxID=44447 RepID=A0A7S0T816_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 4.250e-10 Identity = 28/44 (63.64%), Postives = 32/44 (72.73%), Query Frame = 0 Query: 1 PYFTQQAGKARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVN 44 P T +G RWTLSE D R GLW+WGLFK+PLYPFLLLQ + Sbjct: 125 PQMTVTSG--RWTLSEDPDDRKDGLWIWGLFKEPLYPFLLLQFD 166
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: B5YME2_THAPS (Predicted protein n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B5YME2_THAPS) HSP 1 Score: 61.2 bits (147), Expect = 4.550e-10 Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 0 Query: 9 KARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 48 ++RWTLSE + + GLW+WGLFK+PLYPF+LLQ+ E+ Sbjct: 99 RSRWTLSEDPNDKKDGLWIWGLFKEPLYPFMLLQIETKEL 138
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S0CIY7_9STRA (Hypothetical protein n=1 Tax=Proboscia inermis TaxID=420281 RepID=A0A7S0CIY7_9STRA) HSP 1 Score: 58.5 bits (140), Expect = 1.410e-9 Identity = 22/43 (51.16%), Postives = 31/43 (72.09%), Query Frame = 0 Query: 6 QAGKARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 48 + +RW LSE + R GLW+WGLFK+PLYPF+LL++ E+ Sbjct: 23 ELSSSRWMLSEDPEDRQFGLWIWGLFKEPLYPFMLLEIETKEM 65
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S1E4Z9_9STRA (Hypothetical protein n=1 Tax=Thalassionema nitzschioides TaxID=33649 RepID=A0A7S1E4Z9_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 1.530e-9 Identity = 24/37 (64.86%), Postives = 29/37 (78.38%), Query Frame = 0 Query: 9 KARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNN 45 KA W LSE + R GLWVWGLF+DPLYPF+LLQ++ Sbjct: 4 KAVWKLSEDPNDRKDGLWVWGLFEDPLYPFMLLQIDT 40
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S0B098_9STRA (Hypothetical protein (Fragment) n=1 Tax=Minutocellus polymorphus TaxID=265543 RepID=A0A7S0B098_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 1.790e-9 Identity = 26/39 (66.67%), Postives = 29/39 (74.36%), Query Frame = 0 Query: 10 ARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 48 +RW LSE R GLWVWGLFK+PLYPFLLLQ+ EI Sbjct: 153 SRWQLSEDPSERKDGLWVWGLFKEPLYPFLLLQMETKEI 191
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S2G6H0_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2G6H0_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 2.250e-9 Identity = 25/44 (56.82%), Postives = 32/44 (72.73%), Query Frame = 0 Query: 2 YFTQQA-GKARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVN 44 YF GK RW LSE D R GLW+WGLFK+PLYPF++L+++ Sbjct: 119 YFDSDGKGKNRWLLSEDPDDRKDGLWIWGLFKEPLYPFMILRLS 162
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: C1EGI5_MICCC (Uncharacterized protein n=1 Tax=Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) TaxID=296587 RepID=C1EGI5_MICCC) HSP 1 Score: 59.3 bits (142), Expect = 2.660e-9 Identity = 25/45 (55.56%), Postives = 34/45 (75.56%), Query Frame = 0 Query: 6 QAGKARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQV--NNLEI 48 QAG RWTL+E + R AGLW+WGLF++PLYP++LL N +E+ Sbjct: 111 QAGFHRWTLAEDPNERKAGLWIWGLFEEPLYPYMLLSFDCNRIEV 155 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_Ecto-sp13_S_contig99528.21600.1 ID=prot_Ecto-sp13_S_contig99528.21600.1|Name=mRNA_Ecto-sp13_S_contig99528.21600.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=48bpback to top |