mRNA_Ecto-sp13_S_contig99528.21600.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A6H5KGX1_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KGX1_9PHAE) HSP 1 Score: 105 bits (263), Expect = 8.660e-27 Identity = 47/48 (97.92%), Postives = 48/48 (100.00%), Query Frame = 1 Query: 1 PYFTQQAGKARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 144 PYFTQQAGKARWTLSEAEDTRGAGLWVWGLFK+PLYPFLLLQVNNLEI Sbjct: 153 PYFTQQAGKARWTLSEAEDTRGAGLWVWGLFKEPLYPFLLLQVNNLEI 200
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S2IJE4_9STRA (Hypothetical protein n=2 Tax=Helicotheca tamesis TaxID=374047 RepID=A0A7S2IJE4_9STRA) HSP 1 Score: 63.2 bits (152), Expect = 1.570e-11 Identity = 27/40 (67.50%), Postives = 31/40 (77.50%), Query Frame = 1 Query: 25 KARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 144 K+RW LSE D R GLWVWGLFK+PLYPF+LLQ+ EI Sbjct: 12 KSRWILSEDPDDRKDGLWVWGLFKEPLYPFMLLQLETEEI 51
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S4SSA2_9STRA (Hypothetical protein n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S4SSA2_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 3.370e-10 Identity = 26/40 (65.00%), Postives = 32/40 (80.00%), Query Frame = 1 Query: 25 KARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 144 K+RW LSE + R GLWVWGLFK+PLYPF+LLQ+ + EI Sbjct: 110 KSRWILSEDPNERKDGLWVWGLFKEPLYPFMLLQLESEEI 149
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S0T816_9STRA (Hypothetical protein n=1 Tax=Pseudo-nitzschia delicatissima TaxID=44447 RepID=A0A7S0T816_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 4.250e-10 Identity = 28/44 (63.64%), Postives = 32/44 (72.73%), Query Frame = 1 Query: 1 PYFTQQAGKARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVN 132 P T +G RWTLSE D R GLW+WGLFK+PLYPFLLLQ + Sbjct: 125 PQMTVTSG--RWTLSEDPDDRKDGLWIWGLFKEPLYPFLLLQFD 166
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: B5YME2_THAPS (Predicted protein n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B5YME2_THAPS) HSP 1 Score: 61.2 bits (147), Expect = 4.550e-10 Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1 Query: 25 KARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 144 ++RWTLSE + + GLW+WGLFK+PLYPF+LLQ+ E+ Sbjct: 99 RSRWTLSEDPNDKKDGLWIWGLFKEPLYPFMLLQIETKEL 138
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S0CIY7_9STRA (Hypothetical protein n=1 Tax=Proboscia inermis TaxID=420281 RepID=A0A7S0CIY7_9STRA) HSP 1 Score: 58.5 bits (140), Expect = 1.410e-9 Identity = 22/43 (51.16%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 16 QAGKARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 144 + +RW LSE + R GLW+WGLFK+PLYPF+LL++ E+ Sbjct: 23 ELSSSRWMLSEDPEDRQFGLWIWGLFKEPLYPFMLLEIETKEM 65
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S1E4Z9_9STRA (Hypothetical protein n=1 Tax=Thalassionema nitzschioides TaxID=33649 RepID=A0A7S1E4Z9_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 1.530e-9 Identity = 24/37 (64.86%), Postives = 29/37 (78.38%), Query Frame = 1 Query: 25 KARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNN 135 KA W LSE + R GLWVWGLF+DPLYPF+LLQ++ Sbjct: 4 KAVWKLSEDPNDRKDGLWVWGLFEDPLYPFMLLQIDT 40
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S0B098_9STRA (Hypothetical protein (Fragment) n=1 Tax=Minutocellus polymorphus TaxID=265543 RepID=A0A7S0B098_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 1.790e-9 Identity = 26/39 (66.67%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 28 ARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEI 144 +RW LSE R GLWVWGLFK+PLYPFLLLQ+ EI Sbjct: 153 SRWQLSEDPSERKDGLWVWGLFKEPLYPFLLLQMETKEI 191
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: A0A7S2G6H0_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2G6H0_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 2.250e-9 Identity = 25/44 (56.82%), Postives = 32/44 (72.73%), Query Frame = 1 Query: 4 YFTQQA-GKARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVN 132 YF GK RW LSE D R GLW+WGLFK+PLYPF++L+++ Sbjct: 119 YFDSDGKGKNRWLLSEDPDDRKDGLWIWGLFKEPLYPFMILRLS 162
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Match: C1EGI5_MICCC (Uncharacterized protein n=1 Tax=Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) TaxID=296587 RepID=C1EGI5_MICCC) HSP 1 Score: 59.3 bits (142), Expect = 2.660e-9 Identity = 25/45 (55.56%), Postives = 34/45 (75.56%), Query Frame = 1 Query: 16 QAGKARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQV--NNLEI 144 QAG RWTL+E + R AGLW+WGLF++PLYP++LL N +E+ Sbjct: 111 QAGFHRWTLAEDPNERKAGLWIWGLFEEPLYPYMLLSFDCNRIEV 155 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig99528.21600.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig99528.21600.1 >prot_Ecto-sp13_S_contig99528.21600.1 ID=prot_Ecto-sp13_S_contig99528.21600.1|Name=mRNA_Ecto-sp13_S_contig99528.21600.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=48bp PYFTQQAGKARWTLSEAEDTRGAGLWVWGLFKDPLYPFLLLQVNNLEIback to top mRNA from alignment at Ecto-sp13_S_contig99528:355..498- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig99528.21600.1 ID=mRNA_Ecto-sp13_S_contig99528.21600.1|Name=mRNA_Ecto-sp13_S_contig99528.21600.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=144bp|location=Sequence derived from alignment at Ecto-sp13_S_contig99528:355..498- (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig99528:355..498- >mRNA_Ecto-sp13_S_contig99528.21600.1 ID=mRNA_Ecto-sp13_S_contig99528.21600.1|Name=mRNA_Ecto-sp13_S_contig99528.21600.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=144bp|location=Sequence derived from alignment at Ecto-sp13_S_contig99528:355..498- (Ectocarpus species13 EcNAP12_S_4_19m)back to top |