prot_Ecto-sp13_S_contig10062.86.1 (polypeptide) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig10062.86.1 vs. uniprot
Match: D7G312_ECTSI (50S ribosomal protein L28 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G312_ECTSI) HSP 1 Score: 86.7 bits (213), Expect = 9.380e-21 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0 Query: 1 MYWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVKFTA 43 MYWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVKFTA Sbjct: 87 MYWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVKFTA 129
BLAST of mRNA_Ecto-sp13_S_contig10062.86.1 vs. uniprot
Match: A0A7S3NJI8_9STRA (Hypothetical protein n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3NJI8_9STRA) HSP 1 Score: 60.8 bits (146), Expect = 1.040e-10 Identity = 25/42 (59.52%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 1 MYWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVKFT 42 ++WEEG R+V++R+STKA+KTI KYG++KAAKK+ +DL +F+ Sbjct: 78 LWWEEGNRYVKMRVSTKALKTIAKYGIDKAAKKYQIDLARFS 119
BLAST of mRNA_Ecto-sp13_S_contig10062.86.1 vs. uniprot
Match: A0A7R9U9Q4_9STRA (Hypothetical protein n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9U9Q4_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 9.460e-10 Identity = 27/40 (67.50%), Postives = 35/40 (87.50%), Query Frame = 0 Query: 2 YWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVKF 41 +WEEG R+VR+R+STKAIKTI KYGL ++AKK+ +DL KF Sbjct: 144 WWEEGSRYVRMRVSTKAIKTIKKYGLEESAKKYGVDLSKF 183
BLAST of mRNA_Ecto-sp13_S_contig10062.86.1 vs. uniprot
Match: M1BFS6_SOLTU (50S ribosomal protein L28, chloroplastic n=5 Tax=Solanum TaxID=4107 RepID=M1BFS6_SOLTU) HSP 1 Score: 57.0 bits (136), Expect = 5.900e-9 Identity = 28/40 (70.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 MYWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVK 40 ++WEEGKRFV+LRLSTKAIKTI+K GL+ AKK +DL K Sbjct: 109 IWWEEGKRFVKLRLSTKAIKTIEKNGLDAVAKKAGIDLSK 148
BLAST of mRNA_Ecto-sp13_S_contig10062.86.1 vs. uniprot
Match: A0A6G1EHI2_9ORYZ (Uncharacterized protein n=1 Tax=Oryza meyeriana var. granulata TaxID=110450 RepID=A0A6G1EHI2_9ORYZ) HSP 1 Score: 55.5 bits (132), Expect = 6.420e-9 Identity = 26/40 (65.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 MYWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVK 40 ++WE GKRFV+LRLSTKA+KTI+K+GL+ AKK +DL K Sbjct: 47 LWWEAGKRFVKLRLSTKALKTIEKHGLDAVAKKAGIDLNK 86
BLAST of mRNA_Ecto-sp13_S_contig10062.86.1 vs. uniprot
Match: B8AWJ0_ORYSI (Uncharacterized protein n=2 Tax=Oryza sativa TaxID=4530 RepID=B8AWJ0_ORYSI) HSP 1 Score: 57.8 bits (138), Expect = 7.460e-9 Identity = 27/40 (67.50%), Postives = 35/40 (87.50%), Query Frame = 0 Query: 1 MYWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVK 40 ++WEEGKRFV+LRLSTKA+KTI+K+GL+ AKK +DL K Sbjct: 173 LWWEEGKRFVKLRLSTKALKTIEKHGLDAVAKKAGIDLNK 212
BLAST of mRNA_Ecto-sp13_S_contig10062.86.1 vs. uniprot
Match: A0A7S2RVK4_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2RVK4_9STRA) HSP 1 Score: 56.2 bits (134), Expect = 1.280e-8 Identity = 23/41 (56.10%), Postives = 34/41 (82.93%), Query Frame = 0 Query: 1 MYWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVKF 41 ++W EG R+V LR+STK ++T++KYG++KAAKK+ LDL F Sbjct: 114 LWWPEGDRYVTLRISTKGLRTVEKYGIDKAAKKYGLDLASF 154
BLAST of mRNA_Ecto-sp13_S_contig10062.86.1 vs. uniprot
Match: F0YN12_AURAN (Uncharacterized protein (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YN12_AURAN) HSP 1 Score: 55.5 bits (132), Expect = 1.340e-8 Identity = 24/41 (58.54%), Postives = 35/41 (85.37%), Query Frame = 0 Query: 1 MYWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVKF 41 ++W EG +FV++R+STKA+KTI KYGL K AKK+++DL +F Sbjct: 78 LWWSEGNKFVQMRVSTKALKTIAKYGLGKTAKKYDVDLNEF 118
BLAST of mRNA_Ecto-sp13_S_contig10062.86.1 vs. uniprot
Match: J3M339_ORYBR (Uncharacterized protein n=11 Tax=Oryzinae TaxID=1648021 RepID=J3M339_ORYBR) HSP 1 Score: 55.5 bits (132), Expect = 1.840e-8 Identity = 26/40 (65.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 MYWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVK 40 ++WE GKRFV+LRLSTKA+KTI+K+GL+ AKK +DL K Sbjct: 96 LWWEAGKRFVKLRLSTKALKTIEKHGLDAVAKKAGIDLNK 135
BLAST of mRNA_Ecto-sp13_S_contig10062.86.1 vs. uniprot
Match: A0A8J5W7S7_ZIZPA (Uncharacterized protein n=1 Tax=Zizania palustris TaxID=103762 RepID=A0A8J5W7S7_ZIZPA) HSP 1 Score: 55.5 bits (132), Expect = 1.980e-8 Identity = 26/40 (65.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 MYWEEGKRFVRLRLSTKAIKTIDKYGLNKAAKKFNLDLVK 40 ++WE GKRFV+LRLSTKA+KTI+K+GL+ AKK +DL K Sbjct: 100 LWWEAGKRFVKLRLSTKALKTIEKHGLDAVAKKAGIDLNK 139 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig10062.86.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_Ecto-sp13_S_contig10062.86.1 ID=prot_Ecto-sp13_S_contig10062.86.1|Name=mRNA_Ecto-sp13_S_contig10062.86.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=44bpback to top |