prot_Ecto-sp13_S_contig100333.55.1 (polypeptide) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: D7G866_ECTSI (Kinesin motor domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G866_ECTSI) HSP 1 Score: 117 bits (293), Expect = 3.720e-29 Identity = 55/56 (98.21%), Postives = 56/56 (100.00%), Query Frame = 0 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPEV 56 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE+ Sbjct: 900 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPEL 955
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A7S2UXU2_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2UXU2_9STRA) HSP 1 Score: 73.2 bits (178), Expect = 2.460e-15 Identity = 31/55 (56.36%), Postives = 41/55 (74.55%), Query Frame = 0 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 55 + +KGA+GLP++ A+ QYE G FTTETVEQ+THNP+ EY+ +HHV TPE Sbjct: 27 ISIKGASGLPVITDMAYCQYEFWGEEFTTETVEQNTHNPVWEYTAVHHVANATPE 81
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A7S4D6Y1_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4D6Y1_HETAK) HSP 1 Score: 73.2 bits (178), Expect = 4.550e-14 Identity = 31/55 (56.36%), Postives = 42/55 (76.36%), Query Frame = 0 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 55 + +KGA+GLP++ A+VQYE G F TETVEQ+THNP+ +Y F+HHV+ VT E Sbjct: 62 IKIKGASGLPVITDMAYVQYEFFGEEFVTETVEQNTHNPVFDYEFVHHVDVVTKE 116
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A2D4BME3_PYTIN (C2 domain-containing protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BME3_PYTIN) HSP 1 Score: 73.2 bits (178), Expect = 1.340e-13 Identity = 32/54 (59.26%), Postives = 40/54 (74.07%), Query Frame = 0 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTP 54 + +KGATGLPL+ A+VQYE G LFTTE+VEQ+T NP+ Y +HHV VTP Sbjct: 861 LQIKGATGLPLITDXAYVQYEFLGELFTTESVEQNTRNPVFNYEMVHHVPAVTP 914
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: T0R691_SAPDV (Kinesin motor domain-containing protein n=3 Tax=Saprolegnia TaxID=4769 RepID=T0R691_SAPDV) HSP 1 Score: 71.6 bits (174), Expect = 4.660e-13 Identity = 32/55 (58.18%), Postives = 42/55 (76.36%), Query Frame = 0 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 55 +++KGATGLP++ A+VQYE G LFTTE+VEQ+T NP+ YS +HHV VT E Sbjct: 891 LEIKGATGLPMITDLAYVQYEFLGELFTTESVEQNTRNPVFNYSHVHHVPCVTAE 945
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A1V9YEL4_9STRA (Uncharacterized protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9YEL4_9STRA) HSP 1 Score: 70.9 bits (172), Expect = 8.610e-13 Identity = 32/55 (58.18%), Postives = 41/55 (74.55%), Query Frame = 0 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 55 +++KGATGLP++ A+VQYE G LFTTE+VEQ+T NP YS +HHV VT E Sbjct: 409 LEIKGATGLPMITDLAYVQYEFLGELFTTESVEQNTRNPAFNYSHVHHVPCVTEE 463
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A1V9Z812_9STRA (Kinesin motor domain-containing protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9Z812_9STRA) HSP 1 Score: 68.9 bits (167), Expect = 4.150e-12 Identity = 30/55 (54.55%), Postives = 42/55 (76.36%), Query Frame = 0 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 55 +++KGA+GLP++ A+VQYE G LFTTE+VEQ+T NP+ Y+ +HHV VT E Sbjct: 901 LEIKGASGLPMITDLAYVQYEFLGELFTTESVEQNTRNPVFNYAHVHHVPCVTAE 955
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A8K1CKD3_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1CKD3_PYTOL) HSP 1 Score: 68.6 bits (166), Expect = 5.670e-12 Identity = 31/54 (57.41%), Postives = 39/54 (72.22%), Query Frame = 0 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTP 54 + + GATGLPL+ A+VQYE G LFTTE+VEQ+T NP+ Y +HHV VTP Sbjct: 904 LTIHGATGLPLITDLAYVQYEFLGELFTTESVEQNTRNPVFNYECVHHVSVVTP 957
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: K3X4F7_GLOUD (Kinesin motor domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3X4F7_GLOUD) HSP 1 Score: 67.4 bits (163), Expect = 1.450e-11 Identity = 30/55 (54.55%), Postives = 39/55 (70.91%), Query Frame = 0 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 55 + +KGATGLPL+ A+ QYE G LFTTETVEQ+T +P+ Y +HHV VT + Sbjct: 893 IQIKGATGLPLITDLAYCQYEFLGELFTTETVEQNTRSPVFNYEGIHHVSCVTQQ 947
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A024G4N3_9STRA (Kinesin motor domain-containing protein n=2 Tax=Albugo candida TaxID=65357 RepID=A0A024G4N3_9STRA) HSP 1 Score: 67.0 bits (162), Expect = 1.980e-11 Identity = 28/54 (51.85%), Postives = 38/54 (70.37%), Query Frame = 0 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTP 54 + ++ +GLPL+ A+ QYE G LFTTETVEQ T NP+ Y ++HH+E VTP Sbjct: 909 LQIQAISGLPLITESAYCQYEFLGELFTTETVEQHTRNPVFGYEYVHHIESVTP 962 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_Ecto-sp13_S_contig100333.55.1 ID=prot_Ecto-sp13_S_contig100333.55.1|Name=mRNA_Ecto-sp13_S_contig100333.55.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=64bpback to top |