mRNA_Ecto-sp13_S_contig100333.55.1 (mRNA) Ectocarpus species13 EcNAP12_S_4_19m
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: D7G866_ECTSI (Kinesin motor domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G866_ECTSI) HSP 1 Score: 117 bits (293), Expect = 3.720e-29 Identity = 55/56 (98.21%), Postives = 56/56 (100.00%), Query Frame = 1 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPEV 168 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE+ Sbjct: 900 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPEL 955
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A7S2UXU2_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2UXU2_9STRA) HSP 1 Score: 73.2 bits (178), Expect = 2.460e-15 Identity = 31/55 (56.36%), Postives = 41/55 (74.55%), Query Frame = 1 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 165 + +KGA+GLP++ A+ QYE G FTTETVEQ+THNP+ EY+ +HHV TPE Sbjct: 27 ISIKGASGLPVITDMAYCQYEFWGEEFTTETVEQNTHNPVWEYTAVHHVANATPE 81
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A7S4D6Y1_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4D6Y1_HETAK) HSP 1 Score: 73.2 bits (178), Expect = 4.550e-14 Identity = 31/55 (56.36%), Postives = 42/55 (76.36%), Query Frame = 1 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 165 + +KGA+GLP++ A+VQYE G F TETVEQ+THNP+ +Y F+HHV+ VT E Sbjct: 62 IKIKGASGLPVITDMAYVQYEFFGEEFVTETVEQNTHNPVFDYEFVHHVDVVTKE 116
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A2D4BME3_PYTIN (C2 domain-containing protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BME3_PYTIN) HSP 1 Score: 73.2 bits (178), Expect = 1.340e-13 Identity = 32/54 (59.26%), Postives = 40/54 (74.07%), Query Frame = 1 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTP 162 + +KGATGLPL+ A+VQYE G LFTTE+VEQ+T NP+ Y +HHV VTP Sbjct: 861 LQIKGATGLPLITDXAYVQYEFLGELFTTESVEQNTRNPVFNYEMVHHVPAVTP 914
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: T0R691_SAPDV (Kinesin motor domain-containing protein n=3 Tax=Saprolegnia TaxID=4769 RepID=T0R691_SAPDV) HSP 1 Score: 71.6 bits (174), Expect = 4.660e-13 Identity = 32/55 (58.18%), Postives = 42/55 (76.36%), Query Frame = 1 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 165 +++KGATGLP++ A+VQYE G LFTTE+VEQ+T NP+ YS +HHV VT E Sbjct: 891 LEIKGATGLPMITDLAYVQYEFLGELFTTESVEQNTRNPVFNYSHVHHVPCVTAE 945
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A1V9YEL4_9STRA (Uncharacterized protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9YEL4_9STRA) HSP 1 Score: 70.9 bits (172), Expect = 8.610e-13 Identity = 32/55 (58.18%), Postives = 41/55 (74.55%), Query Frame = 1 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 165 +++KGATGLP++ A+VQYE G LFTTE+VEQ+T NP YS +HHV VT E Sbjct: 409 LEIKGATGLPMITDLAYVQYEFLGELFTTESVEQNTRNPAFNYSHVHHVPCVTEE 463
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A1V9Z812_9STRA (Kinesin motor domain-containing protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9Z812_9STRA) HSP 1 Score: 68.9 bits (167), Expect = 4.150e-12 Identity = 30/55 (54.55%), Postives = 42/55 (76.36%), Query Frame = 1 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 165 +++KGA+GLP++ A+VQYE G LFTTE+VEQ+T NP+ Y+ +HHV VT E Sbjct: 901 LEIKGASGLPMITDLAYVQYEFLGELFTTESVEQNTRNPVFNYAHVHHVPCVTAE 955
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A8K1CKD3_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1CKD3_PYTOL) HSP 1 Score: 68.6 bits (166), Expect = 5.670e-12 Identity = 31/54 (57.41%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTP 162 + + GATGLPL+ A+VQYE G LFTTE+VEQ+T NP+ Y +HHV VTP Sbjct: 904 LTIHGATGLPLITDLAYVQYEFLGELFTTESVEQNTRNPVFNYECVHHVSVVTP 957
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: K3X4F7_GLOUD (Kinesin motor domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3X4F7_GLOUD) HSP 1 Score: 67.4 bits (163), Expect = 1.450e-11 Identity = 30/55 (54.55%), Postives = 39/55 (70.91%), Query Frame = 1 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTPE 165 + +KGATGLPL+ A+ QYE G LFTTETVEQ+T +P+ Y +HHV VT + Sbjct: 893 IQIKGATGLPLITDLAYCQYEFLGELFTTETVEQNTRSPVFNYEGIHHVSCVTQQ 947
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Match: A0A024G4N3_9STRA (Kinesin motor domain-containing protein n=2 Tax=Albugo candida TaxID=65357 RepID=A0A024G4N3_9STRA) HSP 1 Score: 67.0 bits (162), Expect = 1.980e-11 Identity = 28/54 (51.85%), Postives = 38/54 (70.37%), Query Frame = 1 Query: 1 VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVERVTP 162 + ++ +GLPL+ A+ QYE G LFTTETVEQ T NP+ Y ++HH+E VTP Sbjct: 909 LQIQAISGLPLITESAYCQYEFLGELFTTETVEQHTRNPVFGYEYVHHIESVTP 962 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig100333.55.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp13_S_contig100333.55.1 >prot_Ecto-sp13_S_contig100333.55.1 ID=prot_Ecto-sp13_S_contig100333.55.1|Name=mRNA_Ecto-sp13_S_contig100333.55.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=polypeptide|length=64bp VDLKGATGLPLMVSHAFVQYELGGNLFTTETVEQDTHNPLLEYSFLHHVEback to top mRNA from alignment at Ecto-sp13_S_contig100333:314..505- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp13_S_contig100333.55.1 ID=mRNA_Ecto-sp13_S_contig100333.55.1|Name=mRNA_Ecto-sp13_S_contig100333.55.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=mRNA|length=192bp|location=Sequence derived from alignment at Ecto-sp13_S_contig100333:314..505- (Ectocarpus species13 EcNAP12_S_4_19m)back to top Coding sequence (CDS) from alignment at Ecto-sp13_S_contig100333:314..505- >mRNA_Ecto-sp13_S_contig100333.55.1 ID=mRNA_Ecto-sp13_S_contig100333.55.1|Name=mRNA_Ecto-sp13_S_contig100333.55.1|organism=Ectocarpus species13 EcNAP12_S_4_19m|type=CDS|length=192bp|location=Sequence derived from alignment at Ecto-sp13_S_contig100333:314..505- (Ectocarpus species13 EcNAP12_S_4_19m)back to top |