prot_E-siliculosus-1a_F_contig10615.439.1 (polypeptide) Ectocarpus siliculosus Ec863f_EcPH12_90f female

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig10615.439.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
SSRRGGRRKAQAPLRVVVDLREFRSVLPNLLHQQGFELVPLVIAVGDYVLTPQICVERKSLSDLFQSMSSGRLYNQVEAMLKHYKVPVLLIEFNPDK102030405060708090Expect = 1.02e-54 / Id = 100.00Expect = 3.03e-53 / Id = 97.94Expect = 9.97e-38 / Id = 70.21Expect = 1.21e-34 / Id = 61.29Expect = 2.32e-34 / Id = 63.44Expect = 2.47e-34 / Id = 58.06Expect = 3.50e-34 / Id = 56.99Expect = 5.04e-34 / Id = 58.06Expect = 8.04e-34 / Id = 63.44Expect = 8.10e-34 / Id = 61.86SequenceA0A6H5JEA6_9PHAED7FH45_ECTSIA0A6A0A349_HAELAA0A3S3NAZ6_9MAGNUPI001F5D44C3A0A8J4VB27_9ROSIUPI000B8CC7E5A0A103XQW0_CYNCSA0A5J9WL85_9POALA0A1Y1I3K2_KLENI
Match NameE-valueIdentityDescription
A0A6H5JEA6_9PHAE1.020e-54100.00ERCC4 domain-containing protein n=1 Tax=Ectocarpus... [more]
D7FH45_ECTSI3.030e-5397.94ERCC4 domain-containing protein n=1 Tax=Ectocarpus... [more]
A0A6A0A349_HAELA9.970e-3870.21DNA repair endonuclease UVH1 (Fragment) n=1 Tax=Ha... [more]
A0A3S3NAZ6_9MAGN1.210e-3461.29DNA repair endonuclease UVH1 n=1 Tax=Cinnamomum mi... [more]
UPI001F5D44C32.320e-3463.44DNA repair endonuclease UVH1 n=1 Tax=Lolium rigidu... [more]
A0A8J4VB27_9ROSI2.470e-3458.06ERCC4 domain-containing protein n=1 Tax=Castanea m... [more]
UPI000B8CC7E53.500e-3456.99DNA repair endonuclease UVH1-like isoform X3 n=1 T... [more]
A0A103XQW0_CYNCS5.040e-3458.06DNA repair nuclease, XPF-type/Helicase n=3 Tax=Cyn... [more]
A0A5J9WL85_9POAL8.040e-3463.44ERCC4 domain-containing protein n=1 Tax=Eragrostis... [more]
A0A1Y1I3K2_KLENI8.100e-3461.86Structure-specific endonuclease ERCC1-XPF n=1 Tax=... [more]

Pages

back to top