prot_E-siliculosus-1a_M_contig99.17746.1 (polypeptide) Ectocarpus siliculosus Ec864m_EcPH12_78m male
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_E-siliculosus-1a_M_contig99.17746.1 vs. uniprot
Match: D8LDU2_ECTSI (DNA topoisomerase (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDU2_ECTSI) HSP 1 Score: 75.5 bits (184), Expect = 2.340e-14 Identity = 37/43 (86.05%), Postives = 39/43 (90.70%), Query Frame = 0 Query: 17 KVLEPKVPVKRAVFHDITQETLVKAFEGPGQIGENLVQAQEKR 59 +VLEPKVPVKRAVFH+ITQE LVKAFE PGQI ENLVQAQE R Sbjct: 210 QVLEPKVPVKRAVFHEITQEALVKAFEEPGQIDENLVQAQEAR 252
BLAST of mRNA_E-siliculosus-1a_M_contig99.17746.1 vs. uniprot
Match: A0A7Y5SKJ9_9BACT (DNA topoisomerase 1 n=1 Tax=Pirellulales bacterium TaxID=2715253 RepID=A0A7Y5SKJ9_9BACT) HSP 1 Score: 59.3 bits (142), Expect = 1.160e-8 Identity = 25/44 (56.82%), Postives = 37/44 (84.09%), Query Frame = 0 Query: 16 CKVLEPKVPVKRAVFHDITQETLVKAFEGPGQIGENLVQAQEKR 59 C+VL+PKVPV+R VFH+IT+E ++++ + P QI E+LV+AQE R Sbjct: 117 CQVLQPKVPVRRLVFHEITKEAILESLQNPRQIDEDLVRAQETR 160
BLAST of mRNA_E-siliculosus-1a_M_contig99.17746.1 vs. uniprot
Match: A0A3M1SC99_9BACT (DNA topoisomerase 1 n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A3M1SC99_9BACT) HSP 1 Score: 58.5 bits (140), Expect = 2.170e-8 Identity = 26/44 (59.09%), Postives = 36/44 (81.82%), Query Frame = 0 Query: 16 CKVLEPKVPVKRAVFHDITQETLVKAFEGPGQIGENLVQAQEKR 59 C+VLEPKVPV+R VFH+IT+E +++A + P I E+LV+AQE R Sbjct: 115 CQVLEPKVPVRRLVFHEITREAILEALKHPRSIDEHLVKAQEAR 158
BLAST of mRNA_E-siliculosus-1a_M_contig99.17746.1 vs. uniprot
Match: A0A7C4MUI2_9BACT (DNA topoisomerase (Fragment) n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A7C4MUI2_9BACT) HSP 1 Score: 57.4 bits (137), Expect = 5.450e-8 Identity = 26/44 (59.09%), Postives = 33/44 (75.00%), Query Frame = 0 Query: 16 CKVLEPKVPVKRAVFHDITQETLVKAFEGPGQIGENLVQAQEKR 59 C+VL+PKVP+ R VFH+IT E + +A P QI ENLV+AQE R Sbjct: 116 CEVLQPKVPIHRLVFHEITAEAIQEALRQPRQIDENLVRAQETR 159
BLAST of mRNA_E-siliculosus-1a_M_contig99.17746.1 vs. uniprot
Match: A0A1F2TG59_9BACT (DNA topoisomerase 1 n=1 Tax=Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 TaxID=1797183 RepID=A0A1F2TG59_9BACT) HSP 1 Score: 56.6 bits (135), Expect = 1.040e-7 Identity = 24/43 (55.81%), Postives = 36/43 (83.72%), Query Frame = 0 Query: 17 KVLEPKVPVKRAVFHDITQETLVKAFEGPGQIGENLVQAQEKR 59 +VL+PKVPV+R VFH+IT++ + +A + PG++ ENLV+AQE R Sbjct: 111 QVLKPKVPVRRIVFHEITEDAVKEALDHPGRLDENLVRAQESR 153
BLAST of mRNA_E-siliculosus-1a_M_contig99.17746.1 vs. uniprot
Match: A0A7C1FNN9_9BACT (DNA topoisomerase (Fragment) n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A7C1FNN9_9BACT) HSP 1 Score: 55.8 bits (133), Expect = 1.920e-7 Identity = 25/44 (56.82%), Postives = 34/44 (77.27%), Query Frame = 0 Query: 16 CKVLEPKVPVKRAVFHDITQETLVKAFEGPGQIGENLVQAQEKR 59 C+VL+P+VPV+R VFH+IT+E + +A P QI E LV+AQE R Sbjct: 116 CEVLQPQVPVRRLVFHEITEEAIREALSNPRQIDEALVRAQETR 159
BLAST of mRNA_E-siliculosus-1a_M_contig99.17746.1 vs. uniprot
Match: A0A7V4HWP4_9BACT (DNA topoisomerase 1 n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A7V4HWP4_9BACT) HSP 1 Score: 55.8 bits (133), Expect = 1.940e-7 Identity = 25/44 (56.82%), Postives = 33/44 (75.00%), Query Frame = 0 Query: 16 CKVLEPKVPVKRAVFHDITQETLVKAFEGPGQIGENLVQAQEKR 59 C+VL+PKVPV+R VFH+IT+E ++ A P QI LV+AQE R Sbjct: 117 CEVLQPKVPVRRLVFHEITKEAILDALRSPRQIDHALVRAQETR 160
BLAST of mRNA_E-siliculosus-1a_M_contig99.17746.1 vs. uniprot
Match: A0A7X7K818_9ACTO (Omega-protein (Fragment) n=1 Tax=Actinomycetales bacterium TaxID=1911520 RepID=A0A7X7K818_9ACTO) HSP 1 Score: 54.3 bits (129), Expect = 2.210e-7 Identity = 25/43 (58.14%), Postives = 32/43 (74.42%), Query Frame = 0 Query: 17 KVLEPKVPVKRAVFHDITQETLVKAFEGPGQIGENLVQAQEKR 59 +VL+PKVPVKR VFH+IT+E + +A E +I E LV AQE R Sbjct: 109 EVLQPKVPVKRMVFHEITREAIARALEATREIDERLVDAQETR 151
BLAST of mRNA_E-siliculosus-1a_M_contig99.17746.1 vs. uniprot
Match: A0A843T6S0_9BACT (DNA topoisomerase 1 n=1 Tax=Gemmatimonas sp. TaxID=1962908 RepID=A0A843T6S0_9BACT) HSP 1 Score: 55.1 bits (131), Expect = 3.620e-7 Identity = 25/43 (58.14%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 17 KVLEPKVPVKRAVFHDITQETLVKAFEGPGQIGENLVQAQEKR 59 +VLEP+VPV R VFH+IT E + +A + P Q+ ENLV+AQE R Sbjct: 114 QVLEPRVPVSRIVFHEITPEAIREALQHPRQVNENLVRAQETR 156
BLAST of mRNA_E-siliculosus-1a_M_contig99.17746.1 vs. uniprot
Match: A0A7X3YRS4_9SYNE (DNA topoisomerase (Fragment) n=1 Tax=Synechococcus sp. SB0677_bin_5 TaxID=2604870 RepID=A0A7X3YRS4_9SYNE) HSP 1 Score: 54.7 bits (130), Expect = 4.930e-7 Identity = 25/43 (58.14%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 17 KVLEPKVPVKRAVFHDITQETLVKAFEGPGQIGENLVQAQEKR 59 ++L+PKVPVKR VFH+ITQE + +A P + +NLVQAQE R Sbjct: 110 ELLKPKVPVKRLVFHEITQEAIDRALAQPRHLDQNLVQAQEAR 152 The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_M_contig99.17746.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus siliculosus 1a male vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Ectocarpus siliculosus 1a male
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_E-siliculosus-1a_M_contig99.17746.1 ID=prot_E-siliculosus-1a_M_contig99.17746.1|Name=mRNA_E-siliculosus-1a_M_contig99.17746.1|organism=Ectocarpus siliculosus Ec864m_EcPH12_78m male|type=polypeptide|length=67bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|