Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Ectocarpus siliculosus 1a male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR003882 | Pistil-specific extensin-like protein | PRINTS | PR01218 | PSTLEXTENSIN | coord: 47..70 score: 39.58 coord: 82..100 score: 42.11 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..25 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 10..20 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 26..200 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 21..25 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..9 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_E-siliculosus-1a_M_contig95.17484.1 ID=prot_E-siliculosus-1a_M_contig95.17484.1|Name=mRNA_E-siliculosus-1a_M_contig95.17484.1|organism=Ectocarpus siliculosus Ec864m_EcPH12_78m male|type=polypeptide|length=200bp PHAPPPPRPFLAPLALSLLQKSRMSSPCPTSDASAVVIRSSSSPLFPPPP PPAAAPPLCPQASPPPPPPPSPTILLSSVPPPSHPVPPPSPSCPPVNAPP PGKCGPCTTIPPLPGIPPPPSSSSPVRSHSAARSTLPLQAFNASTTRALS NPISASMSTSPGAYPGDVTADADVVGAAATAAAICSDNGREAGGGILAGG back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR003882 | Pistil_extensin |
|