Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Ectocarpus siliculosus 1a male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 1..5 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 29..124 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 6..28 |
None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..18 score: 0.594 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_E-siliculosus-1a_M_contig93.17364.1 ID=prot_E-siliculosus-1a_M_contig93.17364.1|Name=mRNA_E-siliculosus-1a_M_contig93.17364.1|organism=Ectocarpus siliculosus Ec864m_EcPH12_78m male|type=polypeptide|length=125bp MGGVRVLSLVGGVTLVCGLTHELTVYALRAHGEEARPRNNVAQHGERGST QRATCPIPISNDSEGDMRQNSRAQGIHPDQRLTTKRSQRDTFVVTGCSGG AMKGAPPVPFSCLCCSKNTHAQPS* back to top
|