prot_E-siliculosus-1a_F_contig10535.387.1 (polypeptide) Ectocarpus siliculosus Ec863f_EcPH12_90f female
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_E-siliculosus-1a_F_contig10535.387.1 vs. uniprot
Match: D8LN86_ECTSI (Similar to DNA (Cytosine-5-)-methyltransferase (Partial) (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LN86_ECTSI) HSP 1 Score: 108 bits (269), Expect = 3.160e-26 Identity = 44/46 (95.65%), Postives = 45/46 (97.83%), Query Frame = 0 Query: 4 QVRRCGECVPCRSADCGQCRYCVDMPKHGGRGSYKQPCEARKCAWV 49 +VRRCGEC PCRSADCGQCRYCVDMPKHGGRGSYKQPCEARKCAWV Sbjct: 484 KVRRCGECAPCRSADCGQCRYCVDMPKHGGRGSYKQPCEARKCAWV 529
BLAST of mRNA_E-siliculosus-1a_F_contig10535.387.1 vs. uniprot
Match: A0A7S2WD19_9STRA (Hypothetical protein (Fragment) n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WD19_9STRA) HSP 1 Score: 63.2 bits (152), Expect = 3.420e-11 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 0 Query: 7 RCGECVPCRSADCGQCRYCVDMPKHGGRGSYKQPCEARKCAWV 49 RCGEC CR+ +CG CR+C+DMP GG G+ KQ CE R+C V Sbjct: 82 RCGECAGCRAQNCGDCRFCLDMPIFGGPGNLKQGCERRQCMAV 124
BLAST of mRNA_E-siliculosus-1a_F_contig10535.387.1 vs. uniprot
Match: A0A482WLS7_LAOST (Uncharacterized protein n=1 Tax=Laodelphax striatellus TaxID=195883 RepID=A0A482WLS7_LAOST) HSP 1 Score: 55.8 bits (133), Expect = 8.930e-8 Identity = 22/40 (55.00%), Postives = 25/40 (62.50%), Query Frame = 0 Query: 7 RCGECVPCRSADCGQCRYCVDMPKHGGRGSYKQPCEARKC 46 RC C C +DCG+C YC+DMPK GG G KQ C R C Sbjct: 485 RCRTCEACMRSDCGECLYCLDMPKFGGPGKAKQTCMLRNC 524
BLAST of mRNA_E-siliculosus-1a_F_contig10535.387.1 vs. uniprot
Match: UPI00193D4D69 (jmjC domain-containing histone demethylation protein 1-like n=1 Tax=Nilaparvata lugens TaxID=108931 RepID=UPI00193D4D69) HSP 1 Score: 55.5 bits (132), Expect = 1.220e-7 Identity = 22/40 (55.00%), Postives = 25/40 (62.50%), Query Frame = 0 Query: 7 RCGECVPCRSADCGQCRYCVDMPKHGGRGSYKQPCEARKC 46 RC C C+ DCG+C YC+DMPK GG G KQ C R C Sbjct: 482 RCRNCEACQHFDCGECIYCLDMPKFGGPGKAKQTCVKRNC 521
BLAST of mRNA_E-siliculosus-1a_F_contig10535.387.1 vs. uniprot
Match: R1G1Q6_EMIHU (Uncharacterized protein n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1G1Q6_EMIHU) HSP 1 Score: 54.7 bits (130), Expect = 2.280e-7 Identity = 21/40 (52.50%), Postives = 28/40 (70.00%), Query Frame = 0 Query: 7 RCGECVPCRSADCGQCRYCVDMPKHGGRGSYKQPCEARKC 46 RCGEC C + +C R+C+DMPK GG G+ +QPC R+C Sbjct: 502 RCGECEACVAPNCXXXRFCLDMPKFGGVGTLRQPCLQRRC 541
BLAST of mRNA_E-siliculosus-1a_F_contig10535.387.1 vs. uniprot
Match: K0RWQ5_THAOC (Uncharacterized protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0RWQ5_THAOC) HSP 1 Score: 54.7 bits (130), Expect = 2.290e-7 Identity = 20/44 (45.45%), Postives = 31/44 (70.45%), Query Frame = 0 Query: 7 RCGECVPCR-SADCGQCRYCVDMPKHGGRGSYKQPCEARKCAWV 49 +CG+C C+ + DCGQC++C+D PK GG+ +Q C RKC ++ Sbjct: 745 KCGDCTACKITFDCGQCQFCLDKPKFGGKNRLRQTCIKRKCPFM 788
BLAST of mRNA_E-siliculosus-1a_F_contig10535.387.1 vs. uniprot
Match: A0A553P9S0_TIGCA (Uncharacterized protein n=1 Tax=Tigriopus californicus TaxID=6832 RepID=A0A553P9S0_TIGCA) HSP 1 Score: 52.8 bits (125), Expect = 1.090e-6 Identity = 20/39 (51.28%), Postives = 24/39 (61.54%), Query Frame = 0 Query: 8 CGECVPCRSADCGQCRYCVDMPKHGGRGSYKQPCEARKC 46 C C C S DCG C YC DMP+ GG G + PC+ R+C Sbjct: 506 CKICQACISPDCGMCSYCSDMPRFGGPGRMRHPCQMRQC 544
BLAST of mRNA_E-siliculosus-1a_F_contig10535.387.1 vs. uniprot
Match: UPI0015D0BA8D (methyl-CpG-binding domain protein 1a isoform X1 n=3 Tax=Electrophorus electricus TaxID=8005 RepID=UPI0015D0BA8D) HSP 1 Score: 51.6 bits (122), Expect = 2.800e-6 Identity = 20/42 (47.62%), Postives = 27/42 (64.29%), Query Frame = 0 Query: 6 RRCGECVPC-RSADCGQCRYCVDMPKHGGRGSYKQPCEARKC 46 R CG+C C + DCG+C +C+D PK GGR +Q C R+C Sbjct: 451 RMCGQCKACLQDNDCGECDFCMDKPKFGGRNKKRQKCRMRQC 492
BLAST of mRNA_E-siliculosus-1a_F_contig10535.387.1 vs. uniprot
Match: T1J3M7_STRMM (Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1J3M7_STRMM) HSP 1 Score: 51.2 bits (121), Expect = 3.840e-6 Identity = 23/45 (51.11%), Postives = 26/45 (57.78%), Query Frame = 0 Query: 2 SNQVRRCGECVPCRSADCGQCRYCVDMPKHGGRGSYKQPCEARKC 46 S + RC C C DCG+C +CVDM K GGR KQ C RKC Sbjct: 605 SKRKIRCKTCSACTRQDCGECIFCVDMRKFGGRQVLKQCCMYRKC 649 The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig10535.387.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90) Total hits: 9 ZOOMx 1POSITION0
InterPro
Analysis Name: InterProScan on OGS1.0 of Ectocarpus siliculosus 1a female
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_E-siliculosus-1a_F_contig10535.387.1 ID=prot_E-siliculosus-1a_F_contig10535.387.1|Name=mRNA_E-siliculosus-1a_F_contig10535.387.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=polypeptide|length=49bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|