prot_E_fasciculatus_S2_contig9875.17875.1 (polypeptide) Ectocarpus fasciculatus EfasUO2

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_E_fasciculatus_S2_contig9875.17875.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus fasciculatus EfasUO2 vs UniRef90)
Total hits: 6
ZOOM
x 1
POSITION
0
MKTLKHWGFWPSNDAWWFNNVLQPFSKEGNTKCLGSQESVKYASNEQGYLSSLLESGPTRCSVKAFLTDGVQIKLLPATLDYTRKAFSGSSPLNEAEYSKVPRADIPLSGLLKRVGAYTIF*102030405060708090100110120Expect = 4.83e-42 / Id = 62.90Expect = 1.90e-39 / Id = 62.90Expect = 4.11e-39 / Id = 61.29Expect = 1.04e-38 / Id = 60.48Expect = 1.30e-38 / Id = 61.29Expect = 4.04e-34 / Id = 60.68SequenceQ6XLT6_9PHYCA0A6H5K772_9PHAEUPI0000161E53A0A6H5JA56_9PHAEUPI0000161E54D8LP46_ECTSI
Match NameE-valueIdentityDescription
Q6XLT6_9PHYC4.830e-4262.90FirrV-1-M1 n=1 Tax=Feldmannia irregularis virus a ... [more]
A0A6H5K772_9PHAE1.900e-3962.90DDE_Tnp_1 domain-containing protein n=1 Tax=Ectoca... [more]
UPI0000161E534.110e-3961.29EsV-1-178/222 paralog 1 n=1 Tax=Ectocarpus silicul... [more]
A0A6H5JA56_9PHAE1.040e-3860.48DDE_Tnp_1 domain-containing protein n=1 Tax=Ectoca... [more]
UPI0000161E541.300e-3861.29EsV-1-178/222 paralog 2 n=2 Tax=Ectocarpus silicul... [more]
D8LP46_ECTSI4.040e-3460.68Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
back to top