prot_E_fasciculatus_S2_contig9841.17848.1 (polypeptide) Ectocarpus fasciculatus EfasUO2

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_E_fasciculatus_S2_contig9841.17848.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus fasciculatus EfasUO2 vs UniRef90)
Total hits: 6
ZOOM
x 1
POSITION
0
MRAYACLAALVATKVASHPLCVIDERQPDYDQVLTFCDNSIAATGACCTAGACCTDDEEAQVVIDFNAATPVGEELTGECSDLYKQVMCGLTNKLDG*102030405060708090Expect = 1.13e-36 / Id = 76.40Expect = 1.69e-33 / Id = 69.66Expect = 9.87e-28 / Id = 64.84Expect = 7.88e-27 / Id = 62.79Expect = 3.52e-25 / Id = 61.54Expect = 1.16e-11 / Id = 48.35SequenceD7G957_ECTSID7G959_ECTSID7G961_ECTSIA0A6H5K353_9PHAED7G4P3_ECTSID7G6T7_ECTSI
Match NameE-valueIdentityDescription
D7G957_ECTSI1.130e-3676.40Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
D7G959_ECTSI1.690e-3369.66Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
D7G961_ECTSI9.870e-2864.84Glucose sorbosone dehydrogenase n=1 Tax=Ectocarpus... [more]
A0A6H5K353_9PHAE7.880e-2762.79Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
D7G4P3_ECTSI3.520e-2561.54Glucose sorbosone dehydrogenase n=1 Tax=Ectocarpus... [more]
D7G6T7_ECTSI1.160e-1148.35WSC domain-containing protein n=1 Tax=Ectocarpus s... [more]
back to top