|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Ectocarpus fasciculatus EfasUO2
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
| IPR003591 | Leucine-rich repeat, typical subtype | SMART | SM00369 | LRR_typ_2 | coord: 90..113 e-value: 38.0 score: 8.6 coord: 114..138 e-value: 12.0 score: 12.8 coord: 42..66 e-value: 9.4 score: 13.5 |
| IPR001611 | Leucine-rich repeat | PFAM | PF13855 | LRR_8 | coord: 68..127 e-value: 3.5E-11 score: 42.7 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 44..67 score: 5.887 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 116..139 score: 5.687 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 92..114 score: 7.057 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 68..91 score: 4.955 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 20..42 score: 5.225 |
| IPR032675 | Leucine-rich repeat domain superfamily | GENE3D | 3.80.10.10 | | coord: 5..162 e-value: 9.9E-46 score: 158.1 |
| None | No IPR available | PANTHER | PTHR27000:SF268 | | coord: 40..144 |
| None | No IPR available | PANTHER | PTHR27000:SF268 | | coord: 7..96 |
| None | No IPR available | PANTHER | PTHR27000 | FAMILY NOT NAMED | coord: 40..144 coord: 7..96 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 3..11 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 17..162 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..2 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 12..16 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..16 |
| None | No IPR available | SUPERFAMILY | 52058 | L domain-like | coord: 7..152 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_E_fasciculatus_S2_contig9286.17338.1 ID=prot_E_fasciculatus_S2_contig9286.17338.1|Name=mRNA_E_fasciculatus_S2_contig9286.17338.1|organism=Ectocarpus fasciculatus EfasUO2|type=polypeptide|length=162bp MNVLFGLIGVIPTELGRLVTLQQLCLDRNGLTGSIPKELGSLIKLTRFNL SGNKLTESIPADLGRLVRLEVIRLEDNKLTGSIPEALGGLVNLEHLWLSD NNLAGSIPGELGDLVKLETLYLENNKLRGAIPAKLGNLDALSYVQFGNTG SKSIFRRGNKLS back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|