prot_D-mesarthrocarpus_Contig9987.1.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: D7FZK5_ECTSI (AP-3 complex subunit delta n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FZK5_ECTSI) HSP 1 Score: 69.7 bits (169), Expect = 1.320e-12 Identity = 33/36 (91.67%), Postives = 35/36 (97.22%), Query Frame = 0 Query: 1 MRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 36 MRSHPRAVAEHR LVLACLSDDD+TIRTRALELL+G Sbjct: 323 MRSHPRAVAEHRALVLACLSDDDITIRTRALELLTG 358
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A7S3ZNU4_9STRA (AP-3 complex subunit delta n=4 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S3ZNU4_9STRA) HSP 1 Score: 67.8 bits (164), Expect = 6.290e-12 Identity = 32/36 (88.89%), Postives = 34/36 (94.44%), Query Frame = 0 Query: 1 MRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 36 M+SHPRAV EHRELVL CLSDDDVTIRTRALELL+G Sbjct: 323 MKSHPRAVVEHRELVLLCLSDDDVTIRTRALELLTG 358
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A835Z6U0_9STRA (Clathrin/coatomer adaptor, adaptin-like protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z6U0_9STRA) HSP 1 Score: 66.2 bits (160), Expect = 2.180e-11 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 0 Query: 1 MRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 36 M+SHPRAVAE RELVLACL+DDDVTIRTRALELL+G Sbjct: 323 MQSHPRAVAESRELVLACLTDDDVTIRTRALELLTG 358
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: F0YKL7_AURAN (Adaptin_N domain-containing protein (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YKL7_AURAN) HSP 1 Score: 65.5 bits (158), Expect = 4.090e-11 Identity = 30/36 (83.33%), Postives = 34/36 (94.44%), Query Frame = 0 Query: 1 MRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 36 M+SHP+AV EH+ELVL CLSDDDVTIRTRALELL+G Sbjct: 314 MKSHPKAVVEHKELVLLCLSDDDVTIRTRALELLTG 349
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A7S2MSV1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2MSV1_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 7.650e-11 Identity = 30/36 (83.33%), Postives = 33/36 (91.67%), Query Frame = 0 Query: 1 MRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 36 MRSHPR V EH+ELVL+CLSDDDVTIR RALELL+G Sbjct: 322 MRSHPRTVVEHKELVLSCLSDDDVTIRMRALELLTG 357
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A7S1UJH6_9STRA (Hypothetical protein (Fragment) n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1UJH6_9STRA) HSP 1 Score: 63.9 bits (154), Expect = 1.430e-10 Identity = 30/36 (83.33%), Postives = 33/36 (91.67%), Query Frame = 0 Query: 1 MRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 36 MRSHPR+V HRELVL CL+DDDVTIRTRALELL+G Sbjct: 325 MRSHPRSVMAHRELVLRCLNDDDVTIRTRALELLTG 360
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A7R9YB97_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9YB97_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 3.650e-10 Identity = 29/36 (80.56%), Postives = 33/36 (91.67%), Query Frame = 0 Query: 1 MRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 36 MRSHPRAV H++LV+ CLSDDDVTIRTRALELL+G Sbjct: 322 MRSHPRAVMAHQDLVMRCLSDDDVTIRTRALELLTG 357
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A2R5GHQ5_9STRA (AP-3 complex subunit delta n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GHQ5_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 4.990e-10 Identity = 28/36 (77.78%), Postives = 32/36 (88.89%), Query Frame = 0 Query: 1 MRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 36 MRSHPR VAEH+E+VL CL DDDVT+R RALELL+G Sbjct: 323 MRSHPRVVAEHKEMVLQCLMDDDVTVRMRALELLTG 358
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A5A8EBL2_CAFRO (Adaptin_N domain-containing protein n=7 Tax=Sar TaxID=2698737 RepID=A0A5A8EBL2_CAFRO) HSP 1 Score: 61.6 bits (148), Expect = 9.350e-10 Identity = 29/36 (80.56%), Postives = 32/36 (88.89%), Query Frame = 0 Query: 1 MRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 36 M SHPR VAEHR+LVLACL D+DVTIR RALELL+G Sbjct: 331 MLSHPRVVAEHRDLVLACLEDEDVTIRLRALELLTG 366
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A812MKU0_9DINO (AP-3 complex subunit delta n=1 Tax=Symbiodinium sp. KB8 TaxID=230985 RepID=A0A812MKU0_9DINO) HSP 1 Score: 61.2 bits (147), Expect = 1.270e-9 Identity = 29/36 (80.56%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 1 MRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 36 MRSHPR VAEHRE VL CL DDDVTIR +ALELL+G Sbjct: 324 MRSHPRVVAEHREQVLTCLMDDDVTIRLQALELLTG 359 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig9987.1.1 ID=prot_D-mesarthrocarpus_Contig9987.1.1|Name=mRNA_D-mesarthrocarpus_Contig9987.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=52bpback to top |