mRNA_D-mesarthrocarpus_Contig9987.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: D7FZK5_ECTSI (AP-3 complex subunit delta n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FZK5_ECTSI) HSP 1 Score: 85.5 bits (210), Expect = 5.220e-18 Identity = 41/44 (93.18%), Postives = 43/44 (97.73%), Query Frame = 1 Query: 1 GLVGFVNLMRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 132 GLVGFVNLMRSHPRAVAEHR LVLACLSDDD+TIRTRALELL+G Sbjct: 315 GLVGFVNLMRSHPRAVAEHRALVLACLSDDDITIRTRALELLTG 358
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A7S3ZNU4_9STRA (AP-3 complex subunit delta n=4 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S3ZNU4_9STRA) HSP 1 Score: 81.3 bits (199), Expect = 1.610e-16 Identity = 39/44 (88.64%), Postives = 41/44 (93.18%), Query Frame = 1 Query: 1 GLVGFVNLMRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 132 GLVGFV LM+SHPRAV EHRELVL CLSDDDVTIRTRALELL+G Sbjct: 315 GLVGFVELMKSHPRAVVEHRELVLLCLSDDDVTIRTRALELLTG 358
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A835Z6U0_9STRA (Clathrin/coatomer adaptor, adaptin-like protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z6U0_9STRA) HSP 1 Score: 80.9 bits (198), Expect = 2.130e-16 Identity = 39/44 (88.64%), Postives = 43/44 (97.73%), Query Frame = 1 Query: 1 GLVGFVNLMRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 132 GLVG+VNLM+SHPRAVAE RELVLACL+DDDVTIRTRALELL+G Sbjct: 315 GLVGYVNLMQSHPRAVAESRELVLACLTDDDVTIRTRALELLTG 358
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: F0YKL7_AURAN (Adaptin_N domain-containing protein (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YKL7_AURAN) HSP 1 Score: 79.0 bits (193), Expect = 1.040e-15 Identity = 37/44 (84.09%), Postives = 41/44 (93.18%), Query Frame = 1 Query: 1 GLVGFVNLMRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 132 GLVGFV LM+SHP+AV EH+ELVL CLSDDDVTIRTRALELL+G Sbjct: 306 GLVGFVELMKSHPKAVVEHKELVLLCLSDDDVTIRTRALELLTG 349
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A7S2MSV1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2MSV1_9STRA) HSP 1 Score: 78.2 bits (191), Expect = 1.950e-15 Identity = 37/44 (84.09%), Postives = 40/44 (90.91%), Query Frame = 1 Query: 1 GLVGFVNLMRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 132 GLVGFV LMRSHPR V EH+ELVL+CLSDDDVTIR RALELL+G Sbjct: 314 GLVGFVQLMRSHPRTVVEHKELVLSCLSDDDVTIRMRALELLTG 357
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A7S1UJH6_9STRA (Hypothetical protein (Fragment) n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1UJH6_9STRA) HSP 1 Score: 77.4 bits (189), Expect = 3.620e-15 Identity = 37/44 (84.09%), Postives = 40/44 (90.91%), Query Frame = 1 Query: 1 GLVGFVNLMRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 132 GLVGFV LMRSHPR+V HRELVL CL+DDDVTIRTRALELL+G Sbjct: 317 GLVGFVELMRSHPRSVMAHRELVLRCLNDDDVTIRTRALELLTG 360
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: W7TQ06_9STRA (Ap-3 complex subunit delta-1 n=2 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TQ06_9STRA) HSP 1 Score: 76.6 bits (187), Expect = 6.790e-15 Identity = 37/44 (84.09%), Postives = 40/44 (90.91%), Query Frame = 1 Query: 1 GLVGFVNLMRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 132 GLVGFVNLM+S PRAV EH+ELVL CLSDDDVTIR RALELL+G Sbjct: 317 GLVGFVNLMKSFPRAVVEHKELVLLCLSDDDVTIRMRALELLTG 360
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A4D9D9W4_9STRA (Adaptin_N domain-containing protein n=1 Tax=Nannochloropsis salina CCMP1776 TaxID=1027361 RepID=A0A4D9D9W4_9STRA) HSP 1 Score: 76.6 bits (187), Expect = 6.810e-15 Identity = 37/44 (84.09%), Postives = 40/44 (90.91%), Query Frame = 1 Query: 1 GLVGFVNLMRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 132 GLVGFVNLM+S PRAV EH+ELVL CLSDDDVTIR RALELL+G Sbjct: 317 GLVGFVNLMKSFPRAVVEHKELVLLCLSDDDVTIRMRALELLTG 360
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A7R9YB97_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9YB97_9STRA) HSP 1 Score: 76.3 bits (186), Expect = 9.270e-15 Identity = 36/44 (81.82%), Postives = 40/44 (90.91%), Query Frame = 1 Query: 1 GLVGFVNLMRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 132 GLVGFV LMRSHPRAV H++LV+ CLSDDDVTIRTRALELL+G Sbjct: 314 GLVGFVELMRSHPRAVMAHQDLVMRCLSDDDVTIRTRALELLTG 357
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Match: A0A2R5GHQ5_9STRA (AP-3 complex subunit delta n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GHQ5_9STRA) HSP 1 Score: 75.9 bits (185), Expect = 1.270e-14 Identity = 35/44 (79.55%), Postives = 39/44 (88.64%), Query Frame = 1 Query: 1 GLVGFVNLMRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSG 132 GLVG VNLMRSHPR VAEH+E+VL CL DDDVT+R RALELL+G Sbjct: 315 GLVGLVNLMRSHPRVVAEHKEMVLQCLMDDDVTVRMRALELLTG 358 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig9987.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig9987.1.1 >prot_D-mesarthrocarpus_Contig9987.1.1 ID=prot_D-mesarthrocarpus_Contig9987.1.1|Name=mRNA_D-mesarthrocarpus_Contig9987.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=52bp MRSHPRAVAEHRELVLACLSDDDVTIRTRALELLSGAGGGNNAYMPNWILback to top mRNA from alignment at D-mesarthrocarpus_Contig9987:874..1053+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig9987.1.1 ID=mRNA_D-mesarthrocarpus_Contig9987.1.1|Name=mRNA_D-mesarthrocarpus_Contig9987.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=180bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig9987:874..1053+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig9987:874..1053+ >mRNA_D-mesarthrocarpus_Contig9987.1.1 ID=mRNA_D-mesarthrocarpus_Contig9987.1.1|Name=mRNA_D-mesarthrocarpus_Contig9987.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=156bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig9987:874..1053+ (Discosporangium mesarthrocarpum MT17_79)back to top |