prot_D-mesarthrocarpus_Contig989.6.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig989.6.1 vs. uniprot
Match: W7TII5_9STRA (Gag-pol polyprotein n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TII5_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 5.490e-8 Identity = 25/41 (60.98%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 13 YVKQPPGFEQSDPNTGEDYVCKLKRSLYGLHNSSLNWFNTI 53 YVKQPPG+EQ PN GE+ VC+L++SLYGL S NW I Sbjct: 100 YVKQPPGYEQCGPN-GEELVCRLRKSLYGLKQSGRNWHKKI 139
BLAST of mRNA_D-mesarthrocarpus_Contig989.6.1 vs. uniprot
Match: W7T9Y7_9STRA (Retrotransposon ty1-copia subclass n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7T9Y7_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 6.700e-8 Identity = 25/41 (60.98%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 13 YVKQPPGFEQSDPNTGEDYVCKLKRSLYGLHNSSLNWFNTI 53 YVKQPPG+EQ PN GE+ VC L +SLYGL S +NW I Sbjct: 84 YVKQPPGYEQYGPN-GEELVCLLHKSLYGLKQSGINWHKKI 123
BLAST of mRNA_D-mesarthrocarpus_Contig989.6.1 vs. uniprot
Match: W7TIV7_9STRA (Transposable element n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TIV7_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 2.150e-7 Identity = 28/55 (50.91%), Postives = 34/55 (61.82%), Query Frame = 0 Query: 13 YVKQPPGFEQSDPNTGEDYVCKLKRSLYGLHNSSLNWFNTIP--LKETGFTPFQA 65 YVKQPPG+EQ PN G++ VC L++SLYGL S NW I + GF P A Sbjct: 162 YVKQPPGYEQCGPN-GDELVCLLRKSLYGLKQSGRNWHKKIDGWFRGYGFHPSSA 215
BLAST of mRNA_D-mesarthrocarpus_Contig989.6.1 vs. uniprot
Match: W7TJI6_9STRA (Retrotransposon ty1-copia subclass n=2 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TJI6_9STRA) HSP 1 Score: 54.7 bits (130), Expect = 3.830e-7 Identity = 24/41 (58.54%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 13 YVKQPPGFEQSDPNTGEDYVCKLKRSLYGLHNSSLNWFNTI 53 YVKQPPG+EQ PN GE+ +C+L +SLYGL S NW I Sbjct: 142 YVKQPPGYEQYGPN-GEELLCRLHKSLYGLKQSGRNWHKKI 181
BLAST of mRNA_D-mesarthrocarpus_Contig989.6.1 vs. uniprot
Match: W7TCB8_9STRA (Gag-pol polyprotein n=3 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TCB8_9STRA) HSP 1 Score: 55.1 bits (131), Expect = 4.000e-7 Identity = 28/55 (50.91%), Postives = 34/55 (61.82%), Query Frame = 0 Query: 13 YVKQPPGFEQSDPNTGEDYVCKLKRSLYGLHNSSLNWFNTIP--LKETGFTPFQA 65 YVKQPPG+EQ N GE+ VC+L++SLYGL S NW I + GF P A Sbjct: 100 YVKQPPGYEQYGSN-GEELVCRLRKSLYGLKQSGRNWHKKIDGWFRGYGFHPSSA 153
BLAST of mRNA_D-mesarthrocarpus_Contig989.6.1 vs. uniprot
Match: W7T201_9STRA (Gag-pol polyprotein n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7T201_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 7.510e-7 Identity = 25/41 (60.98%), Postives = 28/41 (68.29%), Query Frame = 0 Query: 13 YVKQPPGFEQSDPNTGEDYVCKLKRSLYGLHNSSLNWFNTI 53 YVKQPPG+EQ PN GE+ VC L +SLYGL S NW I Sbjct: 17 YVKQPPGYEQYGPN-GEELVCLLHKSLYGLKQSGRNWHKKI 56
BLAST of mRNA_D-mesarthrocarpus_Contig989.6.1 vs. uniprot
Match: W7TMS9_9STRA (Gag-pol polyprotein n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TMS9_9STRA) HSP 1 Score: 53.5 bits (127), Expect = 1.340e-6 Identity = 27/52 (51.92%), Postives = 33/52 (63.46%), Query Frame = 0 Query: 13 YVKQPPGFEQSDPNTGEDYVCKLKRSLYGLHNSSLNWFNTIP--LKETGFTP 62 YVKQP G+EQ PN GE+ VC+L++SLYGL S NW I + GF P Sbjct: 262 YVKQPIGYEQYGPN-GEELVCRLRKSLYGLKQSGRNWHKKIDGWFRGYGFHP 312
BLAST of mRNA_D-mesarthrocarpus_Contig989.6.1 vs. uniprot
Match: W7T0D1_9STRA (Gag-pol polyprotein n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7T0D1_9STRA) HSP 1 Score: 53.5 bits (127), Expect = 1.430e-6 Identity = 23/41 (56.10%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 13 YVKQPPGFEQSDPNTGEDYVCKLKRSLYGLHNSSLNWFNTI 53 Y+KQPPG+EQ N GE+ VC+L++SLYGL S NW I Sbjct: 358 YIKQPPGYEQYGSN-GEELVCRLRKSLYGLKQSGRNWHKKI 397
BLAST of mRNA_D-mesarthrocarpus_Contig989.6.1 vs. uniprot
Match: A0A7S1SHQ1_9CHLO (Hypothetical protein (Fragment) n=2 Tax=Eukaryota TaxID=2759 RepID=A0A7S1SHQ1_9CHLO) HSP 1 Score: 52.0 bits (123), Expect = 2.200e-6 Identity = 28/53 (52.83%), Postives = 34/53 (64.15%), Query Frame = 0 Query: 11 ESYVKQPPGFEQSDPNTGEDYVCKLKRSLYGLHNSSLNWFNTIP--LKETGFT 61 E Y++QP GF D N GE+ VC LK+SLYGL + NW TI L+E GFT Sbjct: 38 EIYMRQPEGFRHFDIN-GEERVCLLKKSLYGLKQAPRNWNKTITAWLEEYGFT 89
BLAST of mRNA_D-mesarthrocarpus_Contig989.6.1 vs. uniprot
Match: W7TWT0_9STRA (Gag-pol polyprotein n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TWT0_9STRA) HSP 1 Score: 52.8 bits (125), Expect = 2.590e-6 Identity = 23/41 (56.10%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 13 YVKQPPGFEQSDPNTGEDYVCKLKRSLYGLHNSSLNWFNTI 53 Y+KQP G+EQ PN GE+ VC+L++SLYGL S NW I Sbjct: 291 YIKQPIGYEQYGPN-GEELVCRLRKSLYGLKQSGRNWHKKI 330 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig989.6.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig989.6.1 ID=prot_D-mesarthrocarpus_Contig989.6.1|Name=mRNA_D-mesarthrocarpus_Contig989.6.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=70bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|