Homology
The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig9773.1.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR006597 | Sel1-like repeat | SMART | SM00671 | sel1 | coord: 1..27 e-value: 42.0 score: 8.3 coord: 28..63 e-value: 4.7E-7 score: 39.4 |
IPR006597 | Sel1-like repeat | PFAM | PF08238 | Sel1 | coord: 2..25 e-value: 0.065 score: 14.0 coord: 28..63 e-value: 2.0E-6 score: 28.3 |
IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | Tetratricopeptide repeat domain | coord: 1..85 e-value: 2.3E-17 score: 65.0 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 79..135 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 83..104 |
None | No IPR available | SUPERFAMILY | 81901 | HCP-like | coord: 2..77 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig9773.1.1 ID=prot_D-mesarthrocarpus_Contig9773.1.1|Name=mRNA_D-mesarthrocarpus_Contig9773.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=188bp MLYSGVGCLKNYREAAWYYRMAAEANAPAAANAMGLMHELGRGMGQNLAM AAAWYRRAADLGSAEGAFNCALLLERGDPRASSNSPSPPPFFPRAPPSGA PPPLPELQVNTASTIPEKTPPAPVGSGGGGGGGGNGFSVASGGTIGTCKA LLPPLAIGGTLPQPPRCSRGHWGWGTWRQGPSTEDYG* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|