Homology
The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig1027.13.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR018943 | Oligosaccaryltransferase | PFAM | PF10215 | Ost4 | coord: 5..35 e-value: 6.9E-9 score: 35.4 |
IPR036330 | Oligosaccharyltransferase subunit ost4p superfamily | SUPERFAMILY | 103464 | Oligosaccharyltransferase subunit ost4p | coord: 5..35 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig1027.13.1 ID=prot_D-mesarthrocarpus_Contig1027.13.1|Name=mRNA_D-mesarthrocarpus_Contig1027.13.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=41bp MADLDAQLSVVVNCLGIVVFSSIVVYHIVTANPKDTIARQ* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|