prot_D-mesarthrocarpus_Contig10169.1.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10169.1.1 vs. uniprot
Match: D8LG51_ECTSI (TrmE, organellal GTPase involved in tRNA modification n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LG51_ECTSI) HSP 1 Score: 77.0 bits (188), Expect = 4.750e-15 Identity = 49/98 (50.00%), Postives = 53/98 (54.08%), Query Frame = 0 Query: 1 DTIFALATGNAGPAGVAVVRISGPCSGSVLQAMTT---------------------------------------PLPAPRRAVLRRLFDPRTGDLLDE 59 DTIFALATGNAGPAGVAVVRISGP S VLQA+T+ P PA RRAV+RRL+DP TGDLLDE Sbjct: 196 DTIFALATGNAGPAGVAVVRISGPLSAQVLQALTSAANLSSVTAAEASAGGDAGVAASAAPAVVNGGGAGRRLPPFPAARRAVVRRLYDPATGDLLDE 293
BLAST of mRNA_D-mesarthrocarpus_Contig10169.1.1 vs. uniprot
Match: A0A6H5K111_9PHAE (TrmE-type G domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K111_9PHAE) HSP 1 Score: 76.6 bits (187), Expect = 6.470e-15 Identity = 49/99 (49.49%), Postives = 53/99 (53.54%), Query Frame = 0 Query: 1 DTIFALATGNAGPAGVAVVRISGPCSGSVLQAMTT----------------------------------------PLPAPRRAVLRRLFDPRTGDLLDE 59 DTIFALATGNAGPAGVAVVRISGP S VLQA+T+ P PA RRAV+RRL+DP TGDLLDE Sbjct: 32 DTIFALATGNAGPAGVAVVRISGPLSAQVLQALTSATTLSSATAAEASAGRDAGVAXXXXXXXXXXXXXAGRRLPPFPAARRAVVRRLYDPATGDLLDE 130
BLAST of mRNA_D-mesarthrocarpus_Contig10169.1.1 vs. uniprot
Match: UPI00199C6C05 (tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE n=1 Tax=Hyphomicrobiales bacterium TaxID=1909294 RepID=UPI00199C6C05) HSP 1 Score: 68.9 bits (167), Expect = 7.270e-14 Identity = 36/59 (61.02%), Postives = 48/59 (81.36%), Query Frame = 0 Query: 1 DTIFALATGNAGPAGVAVVRISGPCSGSVLQAMTTPLPAPRRAVLRRLFDPRTGDLLDE 59 DTI+A+++G AG AG+AVVR+SGP +G + A+T LPA RRAV+R+L DP TGDLLD+ Sbjct: 5 DTIYAVSSG-AGKAGIAVVRVSGPHAGKAMTALTGSLPASRRAVVRKLGDPATGDLLDQ 62
BLAST of mRNA_D-mesarthrocarpus_Contig10169.1.1 vs. uniprot
Match: UPI000E708D77 (tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE n=1 Tax=Roseomonas vastitatis TaxID=2307076 RepID=UPI000E708D77) HSP 1 Score: 67.0 bits (162), Expect = 1.550e-11 Identity = 37/59 (62.71%), Postives = 46/59 (77.97%), Query Frame = 0 Query: 1 DTIFALATGNAGPAGVAVVRISGPCSGSVLQAMTTPLPAPRRAVLRRLFDPRTGDLLDE 59 DTIFALA+G AG A V+++R+SGP SG++L + LP PRRA LRRL DPR G+LLDE Sbjct: 5 DTIFALASG-AGRAAVSLLRLSGPGSGAILARLAAGLPKPRRASLRRLRDPRDGELLDE 62
BLAST of mRNA_D-mesarthrocarpus_Contig10169.1.1 vs. uniprot
Match: A0A836CK05_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CK05_9STRA) HSP 1 Score: 67.0 bits (162), Expect = 1.570e-11 Identity = 36/65 (55.38%), Postives = 45/65 (69.23%), Query Frame = 0 Query: 1 DTIFALATGNAGPAGVAVVRISGPCSGSVLQAMTTP------LPAPRRAVLRRLFDPRTGDLLDE 59 DTIFAL++G AG AGVAV+R+SGP +G L + T +P RRA +RRL+DP GDLLDE Sbjct: 4 DTIFALSSGPAGQAGVAVIRVSGPAAGDALHTLITAPGRHAKMPEARRAAVRRLYDPVKGDLLDE 68
BLAST of mRNA_D-mesarthrocarpus_Contig10169.1.1 vs. uniprot
Match: A0A1W7M6H9_9SPHN (tRNA modification GTPase MnmE n=5 Tax=unclassified Novosphingobium TaxID=2644732 RepID=A0A1W7M6H9_9SPHN) HSP 1 Score: 66.6 bits (161), Expect = 2.120e-11 Identity = 37/58 (63.79%), Postives = 44/58 (75.86%), Query Frame = 0 Query: 1 DTIFALATGNAGPAGVAVVRISGPCSGSVLQAMTTPLPAPRRAVLRRLFDPRTGDLLD 58 DTIFAL++G PAG+AVVRISGP +G L+A+ LPAPRRA L RL DPR G+ LD Sbjct: 3 DTIFALSSGQP-PAGIAVVRISGPHAGECLRALAGKLPAPRRAALVRLIDPRDGNELD 59
BLAST of mRNA_D-mesarthrocarpus_Contig10169.1.1 vs. uniprot
Match: UPI0018E05130 (tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE n=1 Tax=Roseomonas sp. OP-27 TaxID=2748667 RepID=UPI0018E05130) HSP 1 Score: 64.7 bits (156), Expect = 1.020e-10 Identity = 37/59 (62.71%), Postives = 46/59 (77.97%), Query Frame = 0 Query: 1 DTIFALATGNAGPAGVAVVRISGPCSGSVLQAMTTPLPAPRRAVLRRLFDPRTGDLLDE 59 DTIFALA+G AG A VAV+R+SG SG+++ AM LP PRRA LRRL DP +G++LDE Sbjct: 5 DTIFALASG-AGRAAVAVLRVSGAQSGTIVAAMAGGLPHPRRASLRRLRDPASGEVLDE 62
BLAST of mRNA_D-mesarthrocarpus_Contig10169.1.1 vs. uniprot
Match: UPI001C43B84E (tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE n=2 Tax=Elioraea tepida TaxID=2843330 RepID=UPI001C43B84E) HSP 1 Score: 64.7 bits (156), Expect = 1.020e-10 Identity = 36/58 (62.07%), Postives = 44/58 (75.86%), Query Frame = 0 Query: 1 DTIFALATGNAGPAGVAVVRISGPCSGSVLQAMTTPLPAPRRAVLRRLFDPRTGDLLD 58 DTIFALA+G+ G AGVAV+R+SGP L A+ +P PRRAVLRRL PRTG++LD Sbjct: 13 DTIFALASGS-GRAGVAVIRLSGPAVPEALAALVGGVPEPRRAVLRRLRHPRTGEVLD 69
BLAST of mRNA_D-mesarthrocarpus_Contig10169.1.1 vs. uniprot
Match: A0A6N9BGZ2_9PROT (tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE (Fragment) n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A6N9BGZ2_9PROT) HSP 1 Score: 64.3 bits (155), Expect = 1.160e-10 Identity = 36/58 (62.07%), Postives = 43/58 (74.14%), Query Frame = 0 Query: 1 DTIFALATGNAGPAGVAVVRISGPCSGSVLQAMTTPLPAPRRAVLRRLFDPRTGDLLD 58 DTIFA AT G AG+AV+R+SGP +G L A+ PLP PRRAVLR + DP TG+LLD Sbjct: 3 DTIFAEATAP-GRAGIAVLRLSGPEAGRALAALAGPLPEPRRAVLRAVRDPETGELLD 59
BLAST of mRNA_D-mesarthrocarpus_Contig10169.1.1 vs. uniprot
Match: A0A259IDE4_9SPHN (tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE (Fragment) n=1 Tax=Sphingomonadales bacterium 39-62-4 TaxID=1970599 RepID=A0A259IDE4_9SPHN) HSP 1 Score: 63.9 bits (154), Expect = 1.340e-10 Identity = 36/58 (62.07%), Postives = 43/58 (74.14%), Query Frame = 0 Query: 1 DTIFALATGNAGPAGVAVVRISGPCSGSVLQAMTTPLPAPRRAVLRRLFDPRTGDLLD 58 DTIFAL++G PAG+AV+RISGP SG+ L A+T LPAPRRA L L DP+ G LD Sbjct: 3 DTIFALSSGPP-PAGIAVIRISGPQSGTALTALTGKLPAPRRATLATLADPQDGTHLD 59 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10169.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig10169.1.1 ID=prot_D-mesarthrocarpus_Contig10169.1.1|Name=mRNA_D-mesarthrocarpus_Contig10169.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=59bpback to top |