prot_D-mesarthrocarpus_Contig10143.5.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: D7G5G8_ECTSI (SPG1, Ras superfamily GTPase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5G8_ECTSI) HSP 1 Score: 65.1 bits (157), Expect = 1.210e-11 Identity = 30/36 (83.33%), Postives = 34/36 (94.44%), Query Frame = 0 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 36 QVRGLNR+A+AFLVGTKYD+Y S+P EEQRDIDKQA Sbjct: 112 QVRGLNRSAYAFLVGTKYDLYTSMPAEEQRDIDKQA 147
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A835YI98_9STRA (SPG1, ras superfamily GTPase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YI98_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 1.680e-11 Identity = 30/36 (83.33%), Postives = 33/36 (91.67%), Query Frame = 0 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 36 QVRGLNRNAHAFLVGTKYDI+ +LP EEQ+DIDK A Sbjct: 112 QVRGLNRNAHAFLVGTKYDIFATLPTEEQQDIDKMA 147
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A7S2UXX0_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2UXX0_9STRA) HSP 1 Score: 60.5 bits (145), Expect = 4.420e-10 Identity = 28/36 (77.78%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 36 QVR LNRNAH LVGTKYDI+ +LP EEQ+DIDKQA Sbjct: 111 QVRALNRNAHTLLVGTKYDIFTTLPPEEQQDIDKQA 146
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A6V1K250_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V1K250_HETAK) HSP 1 Score: 59.7 bits (143), Expect = 8.320e-10 Identity = 28/36 (77.78%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 36 Q RGLNRNAHAFLVGTKYDI+ +L EEQ +IDKQA Sbjct: 110 QARGLNRNAHAFLVGTKYDIFTTLSPEEQAEIDKQA 145
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A6U4CJH1_9STRA (Hypothetical protein n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A6U4CJH1_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 1.010e-8 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = 0 Query: 1 QVRGLNRNAHAFLVGTKYDIY-RSLPEEEQRDIDKQA 36 QVRGLNR+AHAFLVGTKYD+Y + L E QRD+DKQA Sbjct: 123 QVRGLNRSAHAFLVGTKYDLYTQQLDEAAQRDVDKQA 159
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A2R5G3V5_9STRA (Septum-promoting GTP-binding protein 1 n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5G3V5_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 5.570e-8 Identity = 24/36 (66.67%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 36 QVRGLN+ A AFL+GTKYD++ +LP EEQ++I KQA Sbjct: 158 QVRGLNKQAFAFLIGTKYDVFATLPHEEQKEITKQA 193
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A7R9U3U1_9STRA (Hypothetical protein n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9U3U1_9STRA) HSP 1 Score: 53.5 bits (127), Expect = 2.830e-7 Identity = 26/37 (70.27%), Postives = 32/37 (86.49%), Query Frame = 0 Query: 1 QVRGLNRNAHAFLVGTKYDIY-RSLPEEEQRDIDKQA 36 QVRGLNR+AHAFLVGTKYD+Y + L E +R++DKQA Sbjct: 181 QVRGLNRSAHAFLVGTKYDLYTQQLDEGARREVDKQA 217
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: F0YJU8_AURAN (Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YJU8_AURAN) HSP 1 Score: 52.4 bits (124), Expect = 4.650e-7 Identity = 24/36 (66.67%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 36 QVRGLNR+A A LVGTKYD++ +LP EEQ +ID+ A Sbjct: 108 QVRGLNRSAFALLVGTKYDVFVTLPPEEQAEIDRNA 143
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A7S4EE64_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S4EE64_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 1.370e-6 Identity = 24/36 (66.67%), Postives = 28/36 (77.78%), Query Frame = 0 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 36 Q RGLNR AHA LVGTKYDI+ +LP EE+ ID+ A Sbjct: 117 QCRGLNRTAHAILVGTKYDIFITLPPEEREAIDRDA 152
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A7S2WAQ5_9STRA (Hypothetical protein n=1 Tax=labyrinthulid quahog parasite QPX TaxID=96639 RepID=A0A7S2WAQ5_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 1.450e-6 Identity = 23/36 (63.89%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 36 QVRGLN+ A AFL+GTKYDI+ +LP +EQ++I K A Sbjct: 193 QVRGLNKQAFAFLIGTKYDIFATLPYDEQKEITKTA 228 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 18 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig10143.5.1 ID=prot_D-mesarthrocarpus_Contig10143.5.1|Name=mRNA_D-mesarthrocarpus_Contig10143.5.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=36bpback to top |