mRNA_D-mesarthrocarpus_Contig10143.5.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: D7G5G8_ECTSI (SPG1, Ras superfamily GTPase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5G8_ECTSI) HSP 1 Score: 65.1 bits (157), Expect = 1.210e-11 Identity = 30/36 (83.33%), Postives = 34/36 (94.44%), Query Frame = 1 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 108 QVRGLNR+A+AFLVGTKYD+Y S+P EEQRDIDKQA Sbjct: 112 QVRGLNRSAYAFLVGTKYDLYTSMPAEEQRDIDKQA 147
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A835YI98_9STRA (SPG1, ras superfamily GTPase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YI98_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 1.680e-11 Identity = 30/36 (83.33%), Postives = 33/36 (91.67%), Query Frame = 1 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 108 QVRGLNRNAHAFLVGTKYDI+ +LP EEQ+DIDK A Sbjct: 112 QVRGLNRNAHAFLVGTKYDIFATLPTEEQQDIDKMA 147
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A7S2UXX0_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2UXX0_9STRA) HSP 1 Score: 60.5 bits (145), Expect = 4.420e-10 Identity = 28/36 (77.78%), Postives = 31/36 (86.11%), Query Frame = 1 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 108 QVR LNRNAH LVGTKYDI+ +LP EEQ+DIDKQA Sbjct: 111 QVRALNRNAHTLLVGTKYDIFTTLPPEEQQDIDKQA 146
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A6V1K250_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V1K250_HETAK) HSP 1 Score: 59.7 bits (143), Expect = 8.320e-10 Identity = 28/36 (77.78%), Postives = 31/36 (86.11%), Query Frame = 1 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 108 Q RGLNRNAHAFLVGTKYDI+ +L EEQ +IDKQA Sbjct: 110 QARGLNRNAHAFLVGTKYDIFTTLSPEEQAEIDKQA 145
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A6U4CJH1_9STRA (Hypothetical protein n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A6U4CJH1_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 1.010e-8 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = 1 Query: 1 QVRGLNRNAHAFLVGTKYDIY-RSLPEEEQRDIDKQA 108 QVRGLNR+AHAFLVGTKYD+Y + L E QRD+DKQA Sbjct: 123 QVRGLNRSAHAFLVGTKYDLYTQQLDEAAQRDVDKQA 159
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A2R5G3V5_9STRA (Septum-promoting GTP-binding protein 1 n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5G3V5_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 5.570e-8 Identity = 24/36 (66.67%), Postives = 31/36 (86.11%), Query Frame = 1 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 108 QVRGLN+ A AFL+GTKYD++ +LP EEQ++I KQA Sbjct: 158 QVRGLNKQAFAFLIGTKYDVFATLPHEEQKEITKQA 193
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A7R9U3U1_9STRA (Hypothetical protein n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9U3U1_9STRA) HSP 1 Score: 53.5 bits (127), Expect = 2.830e-7 Identity = 26/37 (70.27%), Postives = 32/37 (86.49%), Query Frame = 1 Query: 1 QVRGLNRNAHAFLVGTKYDIY-RSLPEEEQRDIDKQA 108 QVRGLNR+AHAFLVGTKYD+Y + L E +R++DKQA Sbjct: 181 QVRGLNRSAHAFLVGTKYDLYTQQLDEGARREVDKQA 217
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: F0YJU8_AURAN (Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YJU8_AURAN) HSP 1 Score: 52.4 bits (124), Expect = 4.650e-7 Identity = 24/36 (66.67%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 108 QVRGLNR+A A LVGTKYD++ +LP EEQ +ID+ A Sbjct: 108 QVRGLNRSAFALLVGTKYDVFVTLPPEEQAEIDRNA 143
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A7S4EE64_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S4EE64_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 1.370e-6 Identity = 24/36 (66.67%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 108 Q RGLNR AHA LVGTKYDI+ +LP EE+ ID+ A Sbjct: 117 QCRGLNRTAHAILVGTKYDIFITLPPEEREAIDRDA 152
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Match: A0A7S2WAQ5_9STRA (Hypothetical protein n=1 Tax=labyrinthulid quahog parasite QPX TaxID=96639 RepID=A0A7S2WAQ5_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 1.450e-6 Identity = 23/36 (63.89%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 1 QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQA 108 QVRGLN+ A AFL+GTKYDI+ +LP +EQ++I K A Sbjct: 193 QVRGLNKQAFAFLIGTKYDIFATLPYDEQKEITKTA 228 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10143.5.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 18 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10143.5.1 >prot_D-mesarthrocarpus_Contig10143.5.1 ID=prot_D-mesarthrocarpus_Contig10143.5.1|Name=mRNA_D-mesarthrocarpus_Contig10143.5.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=36bp QVRGLNRNAHAFLVGTKYDIYRSLPEEEQRDIDKQAback to top mRNA from alignment at D-mesarthrocarpus_Contig10143:4133..4241- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10143.5.1 ID=mRNA_D-mesarthrocarpus_Contig10143.5.1|Name=mRNA_D-mesarthrocarpus_Contig10143.5.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=109bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10143:4133..4241- (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10143:4133..4241- >mRNA_D-mesarthrocarpus_Contig10143.5.1 ID=mRNA_D-mesarthrocarpus_Contig10143.5.1|Name=mRNA_D-mesarthrocarpus_Contig10143.5.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=108bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10143:4133..4241- (Discosporangium mesarthrocarpum MT17_79)back to top |