prot_D-mesarthrocarpus_Contig10135.3.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10135.3.1 vs. uniprot
Match: D8LEI8_ECTSI (Ubiquinol cytochrome c reductase subunit 6 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LEI8_ECTSI) HSP 1 Score: 61.2 bits (147), Expect = 1.900e-11 Identity = 22/31 (70.97%), Postives = 26/31 (83.87%), Query Frame = 0 Query: 10 QACAGRVNAKGFGTCEPWFFDYLKCVDKCVS 40 +AC RV +KGFGTCEPWFFDY+ CVDKC + Sbjct: 31 KACVERVTSKGFGTCEPWFFDYISCVDKCAA 61
BLAST of mRNA_D-mesarthrocarpus_Contig10135.3.1 vs. uniprot
Match: A0A6H5K2B5_9PHAE (UCR_hinge domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2B5_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 5.460e-11 Identity = 22/31 (70.97%), Postives = 26/31 (83.87%), Query Frame = 0 Query: 10 QACAGRVNAKGFGTCEPWFFDYLKCVDKCVS 40 +AC RV +KGFGTCEPWFFDY+ CVDKC + Sbjct: 31 KACVERVISKGFGTCEPWFFDYISCVDKCAA 61
BLAST of mRNA_D-mesarthrocarpus_Contig10135.3.1 vs. uniprot
Match: A0A482RA26_9ARCH (UCR_hinge domain-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482RA26_9ARCH) HSP 1 Score: 53.9 bits (128), Expect = 9.700e-8 Identity = 20/30 (66.67%), Postives = 24/30 (80.00%), Query Frame = 0 Query: 10 QACAGRVNAKGFGTCEPWFFDYLKCVDKCV 39 +AC R+ AKG G+CEPW FDY +CVDKCV Sbjct: 39 EACKERIAAKGTGSCEPWAFDYWRCVDKCV 68
BLAST of mRNA_D-mesarthrocarpus_Contig10135.3.1 vs. uniprot
Match: A0A225V9I9_9STRA (Cytochrome b-c1 n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225V9I9_9STRA) HSP 1 Score: 50.8 bits (120), Expect = 2.100e-7 Identity = 19/30 (63.33%), Postives = 24/30 (80.00%), Query Frame = 0 Query: 10 QACAGRVNAKGFGTCEPWFFDYLKCVDKCV 39 QAC RVNAKG G+C+ +FD+L C+DKCV Sbjct: 20 QACLDRVNAKGVGSCDGQYFDFLHCIDKCV 49
BLAST of mRNA_D-mesarthrocarpus_Contig10135.3.1 vs. uniprot
Match: F0XZK5_AURAN (UCR_hinge domain-containing protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0XZK5_AURAN) HSP 1 Score: 49.3 bits (116), Expect = 9.600e-7 Identity = 17/29 (58.62%), Postives = 23/29 (79.31%), Query Frame = 0 Query: 11 ACAGRVNAKGFGTCEPWFFDYLKCVDKCV 39 +C R+ AKG G CEP++FD+LKC+DKC Sbjct: 30 SCVDRIEAKGGGDCEPYYFDWLKCLDKCA 58
BLAST of mRNA_D-mesarthrocarpus_Contig10135.3.1 vs. uniprot
Match: W2IU60_PHYPR (Cytochrome b-c1 complex subunit 6 n=18 Tax=Phytophthora TaxID=4783 RepID=W2IU60_PHYPR) HSP 1 Score: 46.6 bits (109), Expect = 1.120e-5 Identity = 17/29 (58.62%), Postives = 22/29 (75.86%), Query Frame = 0 Query: 10 QACAGRVNAKGFGTCEPWFFDYLKCVDKC 38 QAC RV AKG G+C+ +FD+L C+DKC Sbjct: 29 QACLDRVKAKGVGSCDGQYFDFLHCIDKC 57 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10135.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 6 ZOOMx 1POSITION0
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig10135.3.1 ID=prot_D-mesarthrocarpus_Contig10135.3.1|Name=mRNA_D-mesarthrocarpus_Contig10135.3.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=41bpback to top |