Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10103.1.1 vs. uniprot
Match:
UPI001CA98769 (Hsp70 family protein n=1 Tax=Dactylosporangium vinaceum TaxID=53362 RepID=UPI001CA98769)
HSP 1 Score: 50.1 bits (118), Expect = 8.050e-5
Identity = 20/37 (54.05%), Postives = 26/37 (70.27%), Query Frame = 0
Query: 2 SPDSRLASSCGDDKTVRLWDVDTQSALHTFFDHDSPV 38
SPD RL ++ GDD+ VR+WD+D+ HT DHD PV
Sbjct: 349 SPDGRLVAAGGDDRKVRIWDIDSALVRHTLSDHDGPV 385
The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10103.1.1 vs. uniprot
Analysis Date: 2022-09-16 (
Diamond blastp: OGS1.0 vs UniRef90 )
Total hits: 1
Y S P D S R L A S S C G D D K T V R L W D V D T Q S A L H T F F D H D S P V G E V R F H P D G T C V A S C S A D K T I K V W D T R S H K L L Q H Y P A H D G E V T S I S F H P S G N F L L S S S A D T S L K V 10 20 30 40 50 60 70 80 90 100 Expect = 8.05e-5 / Id = 54.05 Sequence UPI001CA98769
Match Name E-value Identity Description
UPI001CA98769 8.050e-5 54.05 Hsp70 family protein n=1 Tax=Dactylosporangium vin... [more]
back to top
InterPro
Analysis Name:
InterProScan on OGS1.0
Date Performed: 2022-09-29
Y S P D S R L A S S C G D D K T V R L W D V D T Q S A L H T F F D H D S P V G E V R F H P D G T C V A S C S A D K T I K V W D T R S H K L L Q H Y P A H D G E V T S I S F H P S G N F L L S S S A D T S L K V 10 20 30 40 50 60 70 80 90 100 Score = 34.32 Score = 41.9 Score = 25.47 Expect = 1.3E-10 / Score = 51.2 Expect = 0.045 / Score = 22.9 Expect = 2.4E-4 / Score = 21.8 Expect = 1.3E-8 / Score = 35.4 Expect = 2.0E-7 / Score = 31.6 Score = 14.886235 Score = 12.74747 Score = 12.914561 Expect = 5.5E-36 / Score = 126.1 Score = Score = Score = 11.681953 Score = 12.051043 Score = 9.493783 Score = Score = Score = Sequence PR00320 SM00320 PF00400 PS50082 PS50082 PS50082 G3DSA:2.130.10.10 PTHR44019:SF1 PTHR44019 PS50294 PS50294 PS50294 PS00678 PS00678 SSF50978
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence
>prot_D-mesarthrocarpus_Contig10103.1.1 ID=prot_D-mesarthrocarpus_Contig10103.1.1|Name=mRNA_D-mesarthrocarpus_Contig10103.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=103bp back to top
Annotated Terms
The following terms have been associated with this polypeptide: