prot_D-mesarthrocarpus_Contig1010.1.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: D7G979_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G979_ECTSI) HSP 1 Score: 62.0 bits (149), Expect = 6.940e-11 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0 Query: 6 FFAPNTNTRLGASRDQDGKINVWAVEPKMQVE 37 FFAPN N RLG+SRDQDGK NVWAVEPKM+VE Sbjct: 97 FFAPNENVRLGSSRDQDGKSNVWAVEPKMRVE 128
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A836C6Z0_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836C6Z0_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 7.360e-10 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 0 Query: 6 FFAPNTNTRLGASRDQDGKINVWAVEPKMQVE 37 FF PN N R GASRDQDGK NVWA+EPKM+VE Sbjct: 79 FFQPNANMRYGASRDQDGKSNVWAIEPKMKVE 110
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A835YKW3_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YKW3_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 1.630e-9 Identity = 25/35 (71.43%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 3 AAQFFAPNTNTRLGASRDQDGKINVWAVEPKMQVE 37 A+ FF PN N R GASRDQDGK NVWA+EPKM V+ Sbjct: 83 ASGFFQPNANMRYGASRDQDGKSNVWAIEPKMAVD 117
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A7S2W9V8_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2W9V8_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 1.540e-6 Identity = 23/33 (69.70%), Postives = 25/33 (75.76%), Query Frame = 0 Query: 5 QFFAPNTNTRLGASRDQDGKINVWAVEPKMQVE 37 +FF+ RLG S DQDGK NVWAVEPKMQVE Sbjct: 43 KFFSTPPAQRLGTSVDQDGKSNVWAVEPKMQVE 75
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A7S3NDQ4_9STRA (Hypothetical protein n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3NDQ4_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 1.630e-6 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 0 Query: 7 FAPNTNTRLGASRDQDGKINVWAVEPKMQVE 37 +P +T+LG+S DQDGK N+WAVEPKMQVE Sbjct: 53 LSPPKSTKLGSSIDQDGKSNIWAVEPKMQVE 83
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A7S2IT25_9EUKA (Hypothetical protein n=1 Tax=Haptolina brevifila TaxID=156173 RepID=A0A7S2IT25_9EUKA) HSP 1 Score: 46.6 bits (109), Expect = 2.810e-5 Identity = 22/34 (64.71%), Postives = 25/34 (73.53%), Query Frame = 0 Query: 4 AQFFAPNTNTRLGASRDQDGKINVWAVEPKMQVE 37 AQ P T+LGA+ DQDGK NVWAVEP M+VE Sbjct: 51 AQETPPPPPTKLGATVDQDGKSNVWAVEPSMKVE 84
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A7S2BRW2_9STRA (Hypothetical protein n=1 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2BRW2_9STRA) HSP 1 Score: 47.0 bits (110), Expect = 2.870e-5 Identity = 22/30 (73.33%), Postives = 24/30 (80.00%), Query Frame = 0 Query: 8 APNTNTRLGASRDQDGKINVWAVEPKMQVE 37 A T RLG+S DQDGK NVWAVEPKM+VE Sbjct: 77 AAPTGGRLGSSVDQDGKSNVWAVEPKMEVE 106 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig1010.1.1 ID=prot_D-mesarthrocarpus_Contig1010.1.1|Name=mRNA_D-mesarthrocarpus_Contig1010.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=37bpback to top |