mRNA_D-mesarthrocarpus_Contig1010.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: D7G979_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G979_ECTSI) HSP 1 Score: 63.9 bits (154), Expect = 1.500e-11 Identity = 30/43 (69.77%), Postives = 34/43 (79.07%), Query Frame = 1 Query: 1 PPRDMTAA--QFFAPNTNTRLGASRDQDGKINVWAVEPKMQVE 123 P +D T + FFAPN N RLG+SRDQDGK NVWAVEPKM+VE Sbjct: 86 PAQDATTSVKSFFAPNENVRLGSSRDQDGKSNVWAVEPKMRVE 128
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A836C6Z0_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836C6Z0_9STRA) HSP 1 Score: 59.3 bits (142), Expect = 6.230e-10 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 1 Query: 28 FFAPNTNTRLGASRDQDGKINVWAVEPKMQVE 123 FF PN N R GASRDQDGK NVWA+EPKM+VE Sbjct: 79 FFQPNANMRYGASRDQDGKSNVWAIEPKMKVE 110
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A835YKW3_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YKW3_9STRA) HSP 1 Score: 58.5 bits (140), Expect = 1.380e-9 Identity = 25/35 (71.43%), Postives = 28/35 (80.00%), Query Frame = 1 Query: 19 AAQFFAPNTNTRLGASRDQDGKINVWAVEPKMQVE 123 A+ FF PN N R GASRDQDGK NVWA+EPKM V+ Sbjct: 83 ASGFFQPNANMRYGASRDQDGKSNVWAIEPKMAVD 117
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A7S2W9V8_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2W9V8_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 1.300e-6 Identity = 23/33 (69.70%), Postives = 25/33 (75.76%), Query Frame = 1 Query: 25 QFFAPNTNTRLGASRDQDGKINVWAVEPKMQVE 123 +FF+ RLG S DQDGK NVWAVEPKMQVE Sbjct: 43 KFFSTPPAQRLGTSVDQDGKSNVWAVEPKMQVE 75
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A7S3NDQ4_9STRA (Hypothetical protein n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3NDQ4_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 1.380e-6 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 1 Query: 31 FAPNTNTRLGASRDQDGKINVWAVEPKMQVE 123 +P +T+LG+S DQDGK N+WAVEPKMQVE Sbjct: 53 LSPPKSTKLGSSIDQDGKSNIWAVEPKMQVE 83
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A7S2IT25_9EUKA (Hypothetical protein n=1 Tax=Haptolina brevifila TaxID=156173 RepID=A0A7S2IT25_9EUKA) HSP 1 Score: 47.0 bits (110), Expect = 2.380e-5 Identity = 22/34 (64.71%), Postives = 25/34 (73.53%), Query Frame = 1 Query: 22 AQFFAPNTNTRLGASRDQDGKINVWAVEPKMQVE 123 AQ P T+LGA+ DQDGK NVWAVEP M+VE Sbjct: 51 AQETPPPPPTKLGATVDQDGKSNVWAVEPSMKVE 84
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Match: A0A7S2BRW2_9STRA (Hypothetical protein n=1 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2BRW2_9STRA) HSP 1 Score: 47.4 bits (111), Expect = 2.440e-5 Identity = 22/30 (73.33%), Postives = 24/30 (80.00%), Query Frame = 1 Query: 34 APNTNTRLGASRDQDGKINVWAVEPKMQVE 123 A T RLG+S DQDGK NVWAVEPKM+VE Sbjct: 77 AAPTGGRLGSSVDQDGKSNVWAVEPKMEVE 106 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig1010.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 7 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig1010.1.1 >prot_D-mesarthrocarpus_Contig1010.1.1 ID=prot_D-mesarthrocarpus_Contig1010.1.1|Name=mRNA_D-mesarthrocarpus_Contig1010.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=37bp MTAAQFFAPNTNTRLGASRDQDGKINVWAVEPKMQVEback to top mRNA from alignment at D-mesarthrocarpus_Contig1010:90..212- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig1010.1.1 ID=mRNA_D-mesarthrocarpus_Contig1010.1.1|Name=mRNA_D-mesarthrocarpus_Contig1010.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=123bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig1010:90..212- (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig1010:90..212- >mRNA_D-mesarthrocarpus_Contig1010.1.1 ID=mRNA_D-mesarthrocarpus_Contig1010.1.1|Name=mRNA_D-mesarthrocarpus_Contig1010.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=111bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig1010:90..212- (Discosporangium mesarthrocarpum MT17_79)back to top |