prot_D-mesarthrocarpus_Contig10007.1.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10007.1.1 vs. uniprot
Match: D7FLU9_ECTSI (C6 transcription factor Prf n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLU9_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 4.510e-7 Identity = 34/78 (43.59%), Postives = 40/78 (51.28%), Query Frame = 0 Query: 27 GELPKANGAEVVAAPNGPGARRASCDFCSRRKRKCNGRE-PCQNCSKLNLLCHFSLKRKSG-------RKRKPRPEDE 96 G G + + P GP R SCD C+ RK KC+GRE CQ C + N CH+SLK KSG RK P P E Sbjct: 401 GSSENGRGRDAGSKPAGPKPLRTSCDRCTMRKIKCDGREGKCQRCDRDNQFCHYSLKSKSGPKPNSIRRKSSPTPPRE 478
BLAST of mRNA_D-mesarthrocarpus_Contig10007.1.1 vs. uniprot
Match: A0A1D2VGH0_9ASCO (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ascoidea rubescens DSM 1968 TaxID=1344418 RepID=A0A1D2VGH0_9ASCO) HSP 1 Score: 52.4 bits (124), Expect = 3.560e-5 Identity = 21/35 (60.00%), Postives = 26/35 (74.29%), Query Frame = 0 Query: 50 SCDFCSRRKRKCNGREPCQNCSKLNLLCHFSLKRK 84 +CDFC RRK KCNG PC NC K N +C++SL R+ Sbjct: 56 ACDFCRRRKVKCNGENPCINCFKNNFVCNYSLSRR 90
BLAST of mRNA_D-mesarthrocarpus_Contig10007.1.1 vs. uniprot
Match: A0A836CL14_9STRA (Zn(2)-C6 fungal-type domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CL14_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 6.260e-5 Identity = 34/89 (38.20%), Postives = 44/89 (49.44%), Query Frame = 0 Query: 27 GELPKANGAEVVAA---PNGPGARRASCDFCSRRKRKCNGREPCQNCSKLNLLCHFSLKRKSGRKRKPRPEDEPTTGGVNSGVSTPAVG 112 GE GA V AA N P R SCDFC RRK +C G PCQNC+ +++C S RK++ +P+D G +VG Sbjct: 17 GESGHLAGAHVEAARCKKNRPVKLRKSCDFCWRRKLRCEGGTPCQNCAARSIVCTHSP-----RKQRGKPDDGGEEGSSEHDYEVASVG 100
BLAST of mRNA_D-mesarthrocarpus_Contig10007.1.1 vs. uniprot
Match: A0A6H5L603_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L603_9PHAE) HSP 1 Score: 51.6 bits (122), Expect = 6.470e-5 Identity = 29/60 (48.33%), Postives = 34/60 (56.67%), Query Frame = 0 Query: 50 SCDFCSRRKRKCNGRE-PCQNCSKLNLLCHFSLKRKSGRK----------RKPRPEDEPT 98 SCD C+ RK KC+GRE CQ C + N CH+SLK KSG K R PR E P+ Sbjct: 474 SCDRCTMRKIKCDGREGKCQRCDRDNQFCHYSLKSKSGPKPNSIRRKSSPRSPREESRPS 533
BLAST of mRNA_D-mesarthrocarpus_Contig10007.1.1 vs. uniprot
Match: A0A177VSR3_9BASI (Zn(2)-C6 fungal-type domain-containing protein n=2 Tax=Tilletia TaxID=13289 RepID=A0A177VSR3_9BASI) HSP 1 Score: 51.2 bits (121), Expect = 9.160e-5 Identity = 24/62 (38.71%), Postives = 40/62 (64.52%), Query Frame = 0 Query: 29 LPKANGAEVVAAPNGPGARRASCDFCSRRKRKCNGREPCQNCSKLNLLCHFSLKRKSGRKRK 90 LP ++ A A+ + RRASC+FC RRK +C+G++PC C++ ++C F ++ GR R+ Sbjct: 14 LPPSSAASTSASASFT-PRRASCEFCRRRKIRCDGQDPCAACTQRKIVCVFKVESPKGRPRR 74 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10007.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5 ZOOMx 1POSITION0
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-mesarthrocarpus_Contig10007.1.1 ID=prot_D-mesarthrocarpus_Contig10007.1.1|Name=mRNA_D-mesarthrocarpus_Contig10007.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=135bpback to top |