mRNA_D-mesarthrocarpus_Contig10007.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10007.1.1 vs. uniprot
Match: D7FLU9_ECTSI (C6 transcription factor Prf n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLU9_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 1.470e-6 Identity = 34/78 (43.59%), Postives = 40/78 (51.28%), Query Frame = 3 Query: 213 GELPKANGAEVVAAPNGPGARRASCDFCSRRKRKCNGRE-PCQNCSKLNLLCHFSLKRKSG-------RKRKPRPEDE 422 G G + + P GP R SCD C+ RK KC+GRE CQ C + N CH+SLK KSG RK P P E Sbjct: 401 GSSENGRGRDAGSKPAGPKPLRTSCDRCTMRKIKCDGREGKCQRCDRDNQFCHYSLKSKSGPKPNSIRRKSSPTPPRE 478 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10007.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10007.1.1 >prot_D-mesarthrocarpus_Contig10007.1.1 ID=prot_D-mesarthrocarpus_Contig10007.1.1|Name=mRNA_D-mesarthrocarpus_Contig10007.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=135bp MRGDTGGSDYDSTSDSGWDFGGSGGGGELPKANGAEVVAAPNGPGARRASback to top mRNA from alignment at D-mesarthrocarpus_Contig10007:901..1901- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10007.1.1 ID=mRNA_D-mesarthrocarpus_Contig10007.1.1|Name=mRNA_D-mesarthrocarpus_Contig10007.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=1001bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10007:901..1901- (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10007:901..1901- >mRNA_D-mesarthrocarpus_Contig10007.1.1 ID=mRNA_D-mesarthrocarpus_Contig10007.1.1|Name=mRNA_D-mesarthrocarpus_Contig10007.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=405bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10007:901..1901- (Discosporangium mesarthrocarpum MT17_79)back to top |