mRNA_D-mesarthrocarpus_Contig10184.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10184.1.1 vs. uniprot
Match: A0A0J7NHJ8_LASNI (Gag-pol polyprotein n=1 Tax=Lasius niger TaxID=67767 RepID=A0A0J7NHJ8_LASNI) HSP 1 Score: 53.5 bits (127), Expect = 3.170e-6 Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 1 Query: 61 VATGPDELSTRREASAGEDADKWQEAMDMEMEGQWDKGTFSDDCTPPGRKPVKTRFVYKIKRTADRAIEQ 270 + GPD+ T +EA E D WQ+AM E + + T+ PPGRKP+K ++V+K KR ++ +E+ Sbjct: 781 MVIGPDDPITLQEALESEACDSWQQAMRNEYDALLENKTWDLVDLPPGRKPLKCKWVFKTKRDSNNDVER 850
BLAST of mRNA_D-mesarthrocarpus_Contig10184.1.1 vs. uniprot
Match: A0A0J7KH47_LASNI (Integrase core domain protein (Fragment) n=1 Tax=Lasius niger TaxID=67767 RepID=A0A0J7KH47_LASNI) HSP 1 Score: 50.4 bits (119), Expect = 3.630e-5 Identity = 24/62 (38.71%), Postives = 38/62 (61.29%), Query Frame = 1 Query: 79 ELSTRREASAGEDADKWQEAMDMEMEGQWDKGTFSDDCTPPGRKPVKTRFVYKIKRTADRAI 264 E T EA +ADKW+ A++ E+E + GT+ PPG+KP+ T++V+K+K T A+ Sbjct: 181 EPVTFAEAMRSSEADKWKCAIEEELEAHENNGTWKIVPFPPGKKPIDTKWVFKLKNTVGGAV 242 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10184.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10184.1.1 >prot_D-mesarthrocarpus_Contig10184.1.1 ID=prot_D-mesarthrocarpus_Contig10184.1.1|Name=mRNA_D-mesarthrocarpus_Contig10184.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=90bp QQPRLRTSHDAFCILGLVGEVATGPDELSTRREASAGEDADKWQEAMDMEback to top mRNA from alignment at D-mesarthrocarpus_Contig10184:4197..4466+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10184.1.1 ID=mRNA_D-mesarthrocarpus_Contig10184.1.1|Name=mRNA_D-mesarthrocarpus_Contig10184.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=270bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10184:4197..4466+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10184:4197..4466+ >mRNA_D-mesarthrocarpus_Contig10184.1.1 ID=mRNA_D-mesarthrocarpus_Contig10184.1.1|Name=mRNA_D-mesarthrocarpus_Contig10184.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=270bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10184:4197..4466+ (Discosporangium mesarthrocarpum MT17_79)back to top |